SAXSdb — 2o34

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

Desulfovibrio vulgaris

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SODIUM ION × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SODIUM ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72D34_DESVH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–250； UniProt 2–249 Author chain B； PDBConstruct 3–250； UniProt 2–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2o34
Deposition date deposition_date	2006-11-30
Structure title title	Crystal structure of protein DVU1097 from Desulfovibrio vulgaris Hildenborough, Pfam DUF375
Keywords keywords	;STRUCTURAL GENOMICS, HYPOTHETICAL PROTEIN, PSI, PROTEIN STRUCTURE INITIATIVE, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2o34__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2o34__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2o34__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	18.86 Å
Rg (electron density)	17.82 Å
Total Rg	18.58 Å
Atom count	1855
Residues	241
Excluded volume	33044 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2o34__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2o34__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Hypothetical protein
Molecular weight formula_weight	26920.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3943

SLPMQHVHTSPVRDYRNRCARREGETVFQVVVEETDLRVTALAELATPMAAYVGELRAQLKVWMEFQPAFRHSLVPVEVPEGAPEVVRRMAHGARLVGVGPFAAVAGTIAQMVAERFVDVSPELIVENGGDLYLYSERDRVVGILPDPASGDMVGILVRAGTAPVSLCGSSARIGHSLSLGDGDLAVVRARDASLADAAATAFGNMLRRADDVAAVTERAAQLASIGIEGVYAQCGGRIGIWGDMELAVA

Source Source

Source organism organism	Desulfovibrio vulgaris
NCBI taxonomy ID ncbi_taxonomy_id	881
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	374

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2o34a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.2 — ApbE-like
Family Family family	d.96.2.2 — DVU1097-like

Domain ID domain_id	d2o34a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2o34b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.2 — ApbE-like
Family Family family	d.96.2.2 — DVU1097-like

CATH v4.4 (2 domains)

Domain ID domain_id	2o34A00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	520 — T-fold
Homologous superfamily homologous superfamily	10 — ApbE-like domains

Domain ID domain_id	2o34B00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	520 — T-fold
Homologous superfamily homologous superfamily	10 — ApbE-like domains

▶

Unit-cell length a length_a	60.480 Å
Unit-cell length b length_b	81.480 Å
Unit-cell length c length_c	151.170 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.950 Å
Low-resolution limit resolution_low	19.980 Å
R factor r_factor	0.2130
R_work r_work	0.2100
R_free r_free	0.2730

Crystal structure of protein DVU1097 from Desulfovibrio vulgaris Hildenborough, Pfam DUF375

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o34__assembly_1__model_1

2o34__assembly_1__model_1 | I(q)

2o34__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of protein DVU1097 from Desulfovibrio vulgaris Hildenborough, Pfam DUF375

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hypothetical protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2o34__assembly_1__model_1

2o34__assembly_1__model_1 | I(q)

2o34__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

7. Citations (1)