SAXSdb — 2ofb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Avidin-related protein 4/5

Gallus gallus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 25–150 Chain B； UniProt 25–150	Mutation：R112L, C122S, R312L, C322S	BNI 5-(2-OXO-HEXAHYDRO-THIENO[3,4-D]IMIDAZOL-6-YL)-PENTANOIC ACID (4-NITRO-PHENYL)-AMIDE × 4 FMT FORMIC ACID × 16	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.5；293 K；1.5-1.9M NaFormate, 0.1M Acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.16 Å R-free 0.187

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2OFB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Y52 structure of insect cell (Baculovirus) expressed AVR4 (C122S)-biotin complex Deposited 2004-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 25–150（126 aa） Chain Y 25–150（126 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 BTN BIOTIN × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；2.0M ammonium sulfate,0.1M sodium acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.200
1Y53 Crystal structure of bacterial expressed avidin related protein 4 (AVR4) C122S Deposited 2004-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 25–150（126 aa） Chain Y 25–150（126 aa）	Mutation：C122S Mutation：C122S	FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；2M sodium formate, 0.1M sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.20 Å R-free 0.185
1Y55 Crystal structure of the C122S mutant of E. Coli expressed avidin related protein 4 (AVR4)-biotin complex Deposited 2004-12-02	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 25–150（126 aa） Chain Y 25–150（126 aa）	Mutation：C122S Mutation：C122S	BTN BIOTIN × 4 FMT FORMIC ACID × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；2M sodium formate, 0.1M sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.00 Å R-free 0.177
2FHL avidin related protein (AVR4)-BNA complex Deposited 2005-12-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 25–145（121 aa） Chain B 25–145（121 aa）	Mutation：C122S Mutation：C122S	BNI 5-(2-OXO-HEXAHYDRO-THIENO[3,4-D]IMIDAZOL-6-YL)-PENTANOIC ACID (4-NITRO-PHENYL)-AMIDE × 4 FMT FORMIC ACID × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；3.0M format, 0.1 M acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.05 Å R-free 0.177
2FHN Avidin related protein AVR4 (C122S, K109I mutant) in complex with BNA Deposited 2005-12-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 25–145（121 aa） Chain Y 25–145（121 aa）	Mutation：C122S,K109I Mutation：C122S,K109I	BNI 5-(2-OXO-HEXAHYDRO-THIENO[3,4-D]IMIDAZOL-6-YL)-PENTANOIC ACID (4-NITRO-PHENYL)-AMIDE × 4 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；3. M farmat, 0.1M acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.30 Å R-free 0.166
2MF6 Solution NMR structure of Chimeric Avidin, ChiAVD(I117Y), in the biotin bound form Deposited 2013-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain B 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain C 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain D 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82	Mutation：I117Y Mutation：I117Y Mutation：I117Y Mutation：I117Y	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；333 K；Pressure 1 NMR measurement conditions pH 6.5；333 K；Pressure 1 NMR sample composition 0.7-1.2 mM [U-13C; U-15N] avidin-1, 0.7-1.2 mM d-biotin-2, 93 % H2O-3, 7 % D2O-4, 93% H2O/7% D2O \| 93% H2O/7% D2O NMR sample composition 0.7-1.2 mM [U-13C; U-15N] avidin-5, 0.7-1.2 mM d-biotin-6, 100 % D2O-7, 100% D2O \| 100% D2O	Resolution not provided
2OF8 Crystal structure of AVR4 (D39A/C122S)-BNA complex Deposited 2007-01-03	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 25–150（126 aa） Chain B 25–150（126 aa）	Mutation：D39A, C122S, D239A, C322S Mutation：D39A, C122S, D239A, C322S	BNI 5-(2-OXO-HEXAHYDRO-THIENO[3,4-D]IMIDAZOL-6-YL)-PENTANOIC ACID (4-NITRO-PHENYL)-AMIDE × 4 FMT FORMIC ACID × 22	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.2；293 K；1.5-1.9M NaFormat, 0.1M Acetate, PH 4.2-4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.05 Å R-free 0.177
2OF9 Crystal structure of apo AVR4 (D39A/C122S) Deposited 2007-01-03	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 25–150（126 aa） Chain B 25–150（126 aa）	Mutation：D39A, C122S, D239A, C322S Mutation：D39A, C122S, D239A, C322S	FMT FORMIC ACID × 30	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；293 K；1.5-1.9M NaFormate, 0.1M Acetate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.35 Å R-free 0.192
2OFA Crystal structure of apo AVR4 (R112L,C122S) Deposited 2007-01-03	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 25–150（126 aa） Chain B 25–150（126 aa）	Mutation：R112L, C122S, R312L, C322S Mutation：R112L, C122S, R312L, C322S	FMT FORMIC ACID × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.4；293 K；1.5-1.9M NaFormate, 0.1M Acetate, pH 4.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.50 Å R-free 0.188
3MM0 Crystal structure of chimeric avidin Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain B 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain C 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain D 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82	Mutation：I141Y Mutation：I141Y Mutation：I141Y Mutation：I141Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.3；293 K；20% Polyethylene glycol monomethyl ether 5000, 0.1M Tris (pH 8.3), and 9mM ammonium sulfate, microbatch, temperature 293K	Resolution 2.70 Å R-free 0.309
3MM0 Crystal structure of chimeric avidin Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain F 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain G 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain H 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82	Mutation：I141Y Mutation：I141Y Mutation：I141Y Mutation：I141Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.3；293 K；20% Polyethylene glycol monomethyl ether 5000, 0.1M Tris (pH 8.3), and 9mM ammonium sulfate, microbatch, temperature 293K	Resolution 2.70 Å R-free 0.309
3MM0 Crystal structure of chimeric avidin Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain K 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82	Mutation：I141Y Mutation：I141Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.3；293 K；20% Polyethylene glycol monomethyl ether 5000, 0.1M Tris (pH 8.3), and 9mM ammonium sulfate, microbatch, temperature 293K	Resolution 2.70 Å R-free 0.309
3MM0 Crystal structure of chimeric avidin Deposited 2010-04-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain M 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82 Chain N 62–82（21 aa） Fragment：P02701 Residues 25-61, 85-152 and P56734 residues 62-82	Mutation：I141Y Mutation：I141Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 8.3；293 K；20% Polyethylene glycol monomethyl ether 5000, 0.1M Tris (pH 8.3), and 9mM ammonium sulfate, microbatch, temperature 293K	Resolution 2.70 Å R-free 0.309

10 other PDB entries and 13 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AVR4_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–126； UniProt 25–150 Author chain B； PDBConstruct 1–126； UniProt 25–150

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ofb
Deposition date deposition_date	2007-01-03
Structure title title	Crystal structure of AVR4 (R112L/C122S)-BNA complex
Keywords keywords	avidin, styreptavidin, AVR4, high affinity, pseudo catalysis, LIGAND BINDING PROTEIN; LIGAND BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.45 Å
Radius of gyration Rg (electron density) rg_electron	17.24 Å
Forward intensity I(0) i0	13966300.00
Molecular weight molecular_weight	27772.0 kDa
Excluded volume excluded_volume	34610 Å³
Envelope volume envelope_volume	38897 Å³
Hydration-shell volume shell_volume	18430 Å³
Envelope diameter envelope_diameter	66.6 Å
Shell Rg shell_rg	23.93 Å
Envelope Rg envelope_rg	17.82 Å
Shape Rg shape_rg	17.21 Å
Total Rg total_rg	18.32 Å
Total atoms total_atoms	1955
Residues n_residues	239
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	66.9 Å
Rg (real space) rg_real	18.37 Å
Rg uncertainty (real space) rg_real_error	0.44 Å
I(0) (real space) i0_real	1.3970e+07
I(0) uncertainty (real space) i0_real_error	1.8460e+05
Rg (reciprocal space) rg_reciprocal	18.38 Å
I(0) (reciprocal space) i0_reciprocal	13970000.0000
Solution quality estimate total_estimate	0.7597
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	22.0 Å
Skewness Skewness skewness	0.266
Kurtosis Kurtosis kurtosis	-0.197
Angular range angular_range	— – 0.4300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4323000.0000
Real-space data points n_real_points	74
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.630; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.982; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Avidin-related protein 4/5
Molecular weight formula_weight	14114.9 kDa
Mutation mutation	R112L, C122S, R312L, C322S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2117

ARKCSLTGKWTNNLGSIMTIRAVNSRGEFTGTYLTAVADNPGNITLSPLLGIQHKRASQPTFGFTVHWNFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDISYDWKATLVGYNNFTRLSTVEE

来源 Source

来源生物 organism	Gallus gallus
通用名 common_name	chicken
NCBI Class编号 ncbi_taxonomy_id	9031
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	5-(2-OXO-HEXAHYDRO-THIENO[3,4-D]IMIDAZOL-6-YL)-PENTANOIC ACID (4-NITRO-PHENYL)-AMIDE
Molecular weight formula_weight	364.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	FORMIC ACID
Molecular weight formula_weight	46.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	133

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2ofba1
Class class	b — All beta proteins
Fold Fold fold	b.61 — Streptavidin-like
Superfamily Superfamily superfamily	b.61.1 — Avidin/streptavidin
Family Family family	b.61.1.1 — Avidin/streptavidin

Domain ID domain_id	d2ofba2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2ofbb1
Class class	b — All beta proteins
Fold Fold fold	b.61 — Streptavidin-like
Superfamily Superfamily superfamily	b.61.1 — Avidin/streptavidin
Family Family family	b.61.1.1 — Avidin/streptavidin

Domain ID domain_id	d2ofbb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	2ofbA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	30 — Avidin-like

Domain ID domain_id	2ofbB00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	128 — Lipocalin
Homologous superfamily homologous superfamily	30 — Avidin-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	77.904 Å
Unit-cell length b length_b	77.904 Å
Unit-cell length c length_c	110.326 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.160 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.1774
R_work r_work	0.1769
R_free r_free	0.1875

fit	/app/data/saxs_computation/of/2ofb/2ofb.fit
pddf	/app/data/pr_computation/of/2ofb/2ofb.pr.out
profile	/app/data/saxs_computation/of/2ofb/2ofb.dat

Crystal structure of AVR4 (R112L/C122S)-BNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Avidin-related protein 4/5

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction