2oj5

Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Viral attachment protein sigma 1

Reovirus sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	MAGNESIUM ION × 1 GLYCEROL × 1 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q86337_9REOV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–165； UniProt 293–455 Author chain B； PDBConstruct 3–165； UniProt 293–455 Author chain C； PDBConstruct 3–165； UniProt 293–455 Author chain D； PDBConstruct 3–165； UniProt 293–455 Author chain E； PDBConstruct 3–165； UniProt 293–455 Author chain F； PDBConstruct 3–165； UniProt 293–455

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2oj5
Deposition date deposition_date	2007-01-12
Structure title title	Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution
Keywords keywords	beta-barrel, beta-spiral repeat, aspartic acid cluster, greek key motif, trimer, Viral protein; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2oj5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2oj5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2oj5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.27 Å
Rg (electron density)	21.96 Å
Total Rg	22.94 Å
Atom count	3758
Residues	487
Excluded volume	66519 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2oj5__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2oj5__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Viral attachment protein sigma 1
Molecular weight formula_weight	17921.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	8851

GSSPNLRYPIADVSGGIGMSPNYRFRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTYGAQTVAIGLSSGGTPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT

Source Source

Source organism organism	Reovirus sp.
NCBI taxonomy ID ncbi_taxonomy_id	10891
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1166

▼

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (9 domains)

Domain ID domain_id	d2oj5a1
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

Domain ID domain_id	d2oj5b1
Class class	b — All beta proteins
Fold Fold fold	b.83 — Triple beta-spiral
Superfamily Superfamily superfamily	b.83.1 — Fibre shaft of virus attachment proteins
Family Family family	b.83.1.0 — automated matches

Domain ID domain_id	d2oj5b2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

Domain ID domain_id	d2oj5c1
Class class	b — All beta proteins
Fold Fold fold	b.83 — Triple beta-spiral
Superfamily Superfamily superfamily	b.83.1 — Fibre shaft of virus attachment proteins
Family Family family	b.83.1.0 — automated matches

Domain ID domain_id	d2oj5c2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

Domain ID domain_id	d2oj5d1
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

Domain ID domain_id	d2oj5e1
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

Domain ID domain_id	d2oj5f1
Class class	b — All beta proteins
Fold Fold fold	b.83 — Triple beta-spiral
Superfamily Superfamily superfamily	b.83.1 — Fibre shaft of virus attachment proteins
Family Family family	b.83.1.0 — automated matches

Domain ID domain_id	d2oj5f2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.2 — Reovirus attachment protein sigma 1 head domain

CATH v4.4 (7 domains)

Domain ID domain_id	2oj5A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	2oj5B01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	80 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	2oj5B02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	2oj5C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	2oj5D00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	2oj5E00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

Domain ID domain_id	2oj5F00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	90 — Adenovirus Type 5 Fiber Protein (Receptor Binding Domain)
Homologous superfamily homologous superfamily	20 — Virus attachment protein , globular domain

▶

Unit-cell length a length_a	83.927 Å
Unit-cell length b length_b	51.381 Å
Unit-cell length c length_c	108.870 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.66 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2322
R_work r_work	0.2276
R_free r_free	0.2737

Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Viral attachment protein sigma 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oj5__assembly_1__model_1

2oj5__assembly_1__model_1 | I(q)

2oj5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (9 domains)

CATH v4.4 (7 domains)

7. Citations (1)

Crystal Structure of Reovirus T3D Attachment Protein Sigma1 head domain wild-type at 1.75 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Viral attachment protein sigma 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2oj5__assembly_1__model_1

2oj5__assembly_1__model_1 | I(q)

2oj5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 16 domains

SCOP 2.08 (9 domains)

CATH v4.4 (7 domains)

7. Citations (1)