SAXSdb — 2rad

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Succinoglycan biosynthesis protein

Bacillus cereus ATCC 14579

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q81BN2_BACCR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–443； UniProt 1–443 Author chain B； PDBConstruct 1–443； UniProt 1–443

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2rad
Deposition date deposition_date	2007-09-14
Structure title title	Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135
Keywords keywords	;NESG, BcR135, Succinoglycan biosynthesis protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION, BIOSYNTHETIC PROTEIN ;; BIOSYNTHETIC PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2rad__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2rad__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2rad__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.65 Å
Rg (electron density)	21.87 Å
Total Rg	22.71 Å
Atom count	3230
Residues	395
Excluded volume	57920 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2rad__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2rad__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Succinoglycan biosynthesis protein
Molecular weight formula_weight	51671.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6506

MKKKIIIAIVASAITMTHFVGNTYADSKTEVSVTAPYNTNQIAKWLEAHAKPLKTTNPTASLNDLKPLKNMVGSASIVGLGEATHGAHEVFTMKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNPSQHLTPVFKTKEMLDLLDWIRQYNANPKHKSKVRVIGMDIQSVNENVYNNIIEYIKANNSKLLPRVEEKIKGLIPVTKDMNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNARIIEQFTTMLATPPDKPADFYLKHDIAMYENAKWTEEHLGKTIVWGHNGHVSKTNMLSFIYPKVAGQHLAEYYGKRYVSIGTSVYEGQYNVKNSDGEFGPYGTLKSDDPNSYNYIFGQVKKDQFFIDLRKANGVTKTWLNEQHPIFAGITTEGPDIPKTVDISLGKAFDILVQIQKVSPSQVHQLEHHHHHH

Source Source

Source organism organism	Bacillus cereus ATCC 14579
NCBI taxonomy ID ncbi_taxonomy_id	226900
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	31

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2rada1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.150 — EreA/ChaN-like
Superfamily Superfamily superfamily	c.150.1 — EreA/ChaN-like
Family Family family	c.150.1.3 — EreA-like

Domain ID domain_id	d2radb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.150 — EreA/ChaN-like
Superfamily Superfamily superfamily	c.150.1 — EreA/ChaN-like
Family Family family	c.150.1.3 — EreA-like

CATH v4.4 (6 domains)

Domain ID domain_id	2radA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1660 — EreA/ChaN-like fold
Homologous superfamily homologous superfamily	10 — EreA-like (biosynthetic domain)

Domain ID domain_id	2radA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1870 — EreA/ChaN-like, small alpha-beta sandwich
Homologous superfamily homologous superfamily	10 — EreA-like; domain 2

Domain ID domain_id	2radA03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	30 — Biosynthetic Protein domain

Domain ID domain_id	2radB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1660 — EreA/ChaN-like fold
Homologous superfamily homologous superfamily	10 — EreA-like (biosynthetic domain)

Domain ID domain_id	2radB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1870 — EreA/ChaN-like, small alpha-beta sandwich
Homologous superfamily homologous superfamily	10 — EreA-like; domain 2

Domain ID domain_id	2radB03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	30 — Biosynthetic Protein domain

▶

Unit-cell length a length_a	87.786 Å
Unit-cell length b length_b	54.187 Å
Unit-cell length c length_c	98.911 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	97.20 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	19.930 Å
R factor r_factor	0.2090
R_work r_work	0.2090
R_free r_free	0.2810

Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135

1. Protein Identity and Related Structures Protein Identity & Related Structures

Succinoglycan biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rad__assembly_1__model_1

2rad__assembly_1__model_1 | I(q)

2rad__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (2 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of the succinoglycan biosynthesis protein. Northeast structural Genomics Consortium target BcR135

1. Protein Identity and Related Structures Protein Identity & Related Structures

Succinoglycan biosynthesis protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rad__assembly_1__model_1

2rad__assembly_1__model_1 | I(q)

2rad__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (2 domains)

CATH v4.4 (6 domains)

7. Citations (1)