SAXSdb — 2rgt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

synthetic construct

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	ZINC ION × 8 water × 2	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHX3_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–128； UniProt 28–153 Author chain B； PDBConstruct 3–128； UniProt 28–153

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

synthetic construct

UniProt P61372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	ZINC ION × 8 water × 2	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	ZINC ION × 4 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISL1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 140–169； UniProt 262–291 Author chain B； PDBConstruct 140–169； UniProt 262–291

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2rgt
Deposition date deposition_date	2007-10-05
Structure title title	Crystal Structure of Lhx3 LIM domains 1 and 2 with the binding domain of Isl1
Keywords keywords	;protein-protein complex, LIM domain, Zn finger, Activator, DNA-binding, Homeobox, Metal-binding, Nucleus, Transcription, Transcription regulation, METAL BINDING PROTEIN ;; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2rgt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2rgt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2rgt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.47 Å
Rg (electron density)	24.86 Å
Total Rg	25.67 Å
Atom count	2328
Residues	296
Excluded volume	41208 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2rgt__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2rgt__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1
Molecular weight formula_weight	18603.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2425

GSTPEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQGGSGGSGGSGGGTPMVAASPERHDGGLQANPVEVQSYQPPW

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	48

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	2rgtB01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	110 — Cysteine Rich Protein
Homologous superfamily homologous superfamily	10 — Cysteine Rich Protein

Domain ID domain_id	2rgtB02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	110 — Cysteine Rich Protein
Homologous superfamily homologous superfamily	10 — Cysteine Rich Protein

▶

Unit-cell length a length_a	119.494 Å
Unit-cell length b length_b	62.218 Å
Unit-cell length c length_c	51.885 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.61 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.050 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.2140
R_work r_work	0.2110
R_free r_free	0.2540

Crystal Structure of Lhx3 LIM domains 1 and 2 with the binding domain of Isl1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

State in the Current Structure

Other States of the Same Protein in the Database

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rgt__assembly_1__model_1

2rgt__assembly_1__model_1 | I(q)

2rgt__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of Lhx3 LIM domains 1 and 2 with the binding domain of Isl1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion of LIM/homeobox protein Lhx3, linker, Insulin gene enhancer protein ISL-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2rgt__assembly_1__model_1

2rgt__assembly_1__model_1 | I(q)

2rgt__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)