2v74

Crystal structure of coactivator-associated arginine methyltransferase 1 (CARM1), in complex with S-adenosyl-homocysteine

Method: X-RAY DIFFRACTION D_max: 128.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HISTONE-ARGININE METHYLTRANSFERASE CARM1

MUS MUSCULUS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 147–490 Chain D； UniProt 147–490	Fragment：CATALYTIC DOMAIN, RESIDUES 147-490	SAH S-ADENOSYL-L-HOMOCYSTEINE × 4	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7；1.6M DI-AMMONIUM HYDROGENPHOSPHATE, 100MM HEPES PH 7.5.	Resolution 2.70 Å R-free 0.273
2	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain F； UniProt 147–490 Chain H； UniProt 147–490	Fragment：CATALYTIC DOMAIN, RESIDUES 147-490	SAH S-ADENOSYL-L-HOMOCYSTEINE × 4	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7；1.6M DI-AMMONIUM HYDROGENPHOSPHATE, 100MM HEPES PH 7.5.	Resolution 2.70 Å R-free 0.273

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2V74	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2V7E Crystal structure of coactivator-associated arginine methyltransferase 1 (CARM1), unliganded Deposited 2007-07-30	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 147–490（344 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 147-490 Chain B 147–490（344 aa） Fragment：CATALYTIC DOMAIN, RESIDUES 147-490	Not recorded	HG MERCURY (II) ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；1.6M DI-AMMONIUM HYDROGENPHOSPHATE, 100MM HEPES PH 7.5	Resolution 2.70 Å R-free 0.276
5IH3 Crystal structure of mouse CARM1 in complex with SAH at 1.8 Angstroms resolution Deposited 2016-02-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Fragment：UNP residues 130-487 Chain B 130–487（358 aa） Fragment：UNP residues 130-487 Chain C 130–487（358 aa） Fragment：UNP residues 130-487 Chain D 130–487（358 aa） Fragment：UNP residues 130-487	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 4 EDO 1,2-ETHANEDIOL × 11 PEG DI(HYDROXYETHYL)ETHER × 6 PGE TRIETHYLENE GLYCOL × 1 PE8 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL × 1 DXE 1,2-DIMETHOXYETHANE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM, PEG 2000 MME 19%, NaCl 167 mM	Resolution 1.77 Å R-free 0.191
5IS6 Crystal structure of mouse CARM1 in complex with Sinefungin at 2.0 Angstroms resolution Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	PG4 TETRAETHYLENE GLYCOL × 3 EDO 1,2-ETHANEDIOL × 8 PEG DI(HYDROXYETHYL)ETHER × 3 DXE 1,2-DIMETHOXYETHANE × 6 SFG SINEFUNGIN × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 28 % NaCl 100 mM	Resolution 2.01 Å R-free 0.177
5IS7 Crystal structure of mouse CARM1 in complex with decarboxylated SAH Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 5 PEG DI(HYDROXYETHYL)ETHER × 2 DSH 5'-S-(3-aminopropyl)-5'-thioadenosine × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 25% NaCl 167 mM	Resolution 2.29 Å R-free 0.247
5IS8 Crystal structure of mouse CARM1 in complex with inhibitor SA0271 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–507（378 aa） Chain B 130–507（378 aa） Chain C 130–507（378 aa） Chain D 130–507（378 aa）	Not recorded	6D1 5'-{[(3S)-3-amino-3-carboxypropyl](2-chloroethyl)amino}-5'-deoxyadenosine × 3 EDO 1,2-ETHANEDIOL × 3 SAH S-ADENOSYL-L-HOMOCYSTEINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；290 K；BTP pH 7.5 100 mM, PEG 3350 15%	Resolution 2.71 Å R-free 0.242
5IS9 Crystal structure of mouse CARM1 in complex with inhibitor SA0375 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6D3 (2S)-2-amino-4-[(3-{4-[(2S)-2-amino-2-carboxyethyl]-1H-1,2,3-triazol-1-yl}propyl){[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl}amino]butanoic acid (non-preferred name) × 4 EDO 1,2-ETHANEDIOL × 16 PEG DI(HYDROXYETHYL)ETHER × 4 DXE 1,2-DIMETHOXYETHANE × 2 PG4 TETRAETHYLENE GLYCOL × 1 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 13 % NaCl 100 mM	Resolution 2.40 Å R-free 0.206
5ISA Crystal structure of mouse CARM1 in complex with inhibitor SA0401 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–490（361 aa） Chain B 130–490（361 aa） Chain C 130–490（361 aa） Chain D 130–490（361 aa）	Not recorded	6D5 (2~{S})-4-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-(3-azidopropyl)amino]-2-azanyl-butanoic acid × 4 EDO 1,2-ETHANEDIOL × 8 DXE 1,2-DIMETHOXYETHANE × 3 PEG DI(HYDROXYETHYL)ETHER × 1 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 PG4 TETRAETHYLENE GLYCOL × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；290 K；MIB pH 7.0 100 mM PEG 1500 17.5 % NaCl 100 mM	Resolution 2.40 Å R-free 0.204
5ISB Crystal structure of mouse CARM1 in complex with inhibitor SA0435 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6CX 5'-{[(3S)-3-amino-3-carboxypropyl][(1H-imidazol-4-yl)methyl]amino}-5'-deoxyadenosine × 4 EDO 1,2-ETHANEDIOL × 16 PEG DI(HYDROXYETHYL)ETHER × 7 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 19% NaCl 133 mM	Resolution 2.00 Å R-free 0.190
5ISC Crystal structure of mouse CARM1 in complex with inhibitor SA0491 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 2 EDO 1,2-ETHANEDIOL × 6 6D0 5'-{[(3S)-3-amino-3-carboxypropyl](3-bromo-2-oxopropyl)amino}-5'-deoxyadenosine × 2 DXE 1,2-DIMETHOXYETHANE × 2 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 19 %	Resolution 2.60 Å R-free 0.239
5ISD Crystal structure of mouse CARM1 in complex with inhibitor SA0592 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 9 PEG DI(HYDROXYETHYL)ETHER × 3 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 3 6CZ 5'-{[(3S)-3-amino-3-carboxypropyl](3-ethoxy-2,3-dioxopropyl)amino}-5'-deoxyadenosine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 19 % NaCl 133 mM	Resolution 2.60 Å R-free 0.226
5ISE Crystal structure of mouse CARM1 in complex with inhibitor SA0649 Deposited 2016-03-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa）	Not recorded	6D2 5'-{[(3S)-3-amino-3-carboxypropyl](3-carbamimidamidopropyl)amino}-5'-deoxyadenosine × 4 EDO 1,2-ETHANEDIOL × 4 PGE TRIETHYLENE GLYCOL × 2 DXE 1,2-DIMETHOXYETHANE × 4 PEG DI(HYDROXYETHYL)ETHER × 4 PE8 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 15 % NaCl 133 mM	Resolution 2.10 Å R-free 0.200
5ISE Crystal structure of mouse CARM1 in complex with inhibitor SA0649 Deposited 2016-03-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6D2 5'-{[(3S)-3-amino-3-carboxypropyl](3-carbamimidamidopropyl)amino}-5'-deoxyadenosine × 4 EDO 1,2-ETHANEDIOL × 4 DXE 1,2-DIMETHOXYETHANE × 4 PEG DI(HYDROXYETHYL)ETHER × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 15 % NaCl 133 mM	Resolution 2.10 Å R-free 0.200
5ISF Crystal structure of mouse CARM1 in complex with inhibitor SA0705 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6D4 5'-{[(3S)-3-amino-3-carboxypropyl][2-(triazan-1-yl)ethyl]amino}-5'-deoxyadenosine × 3 EDO 1,2-ETHANEDIOL × 7 PEG DI(HYDROXYETHYL)ETHER × 1 PG4 TETRAETHYLENE GLYCOL × 3 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 2 DXE 1,2-DIMETHOXYETHANE × 4 SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 10 % NaCl 167 mM	Resolution 2.22 Å R-free 0.201
5ISG Crystal structure of mouse CARM1 in complex with inhibitor SA0707 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	DXE 1,2-DIMETHOXYETHANE × 3 EDO 1,2-ETHANEDIOL × 18 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1 PEG DI(HYDROXYETHYL)ETHER × 2 6D6 5'-{[(3S)-3-amino-3-carboxypropyl](3-aminopropyl)amino}-5'-deoxyadenosine × 4 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 22% NaCl 200 mM	Resolution 2.42 Å R-free 0.207
5ISH Crystal structure of mouse CARM1 in complex with inhibitor SA0765 Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	765 5'-{1-[(3S)-3-amino-3-carboxypropyl]aziridin-1-ium-1-yl}-5'-deoxyadenosine × 4 EDO 1,2-ETHANEDIOL × 8 PEG DI(HYDROXYETHYL)ETHER × 4 DXE 1,2-DIMETHOXYETHANE × 6 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 17 % NaCl 67 mM	Resolution 2.15 Å R-free 0.198
5ISI Crystal structure of mouse CARM1 in complex with inhibitor SA0920 (5'-amino-5'-deoxyadenosine) Deposited 2016-03-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	5N5 5'-amino-5'-deoxyadenosine × 4 EDO 1,2-ETHANEDIOL × 6 DXE 1,2-DIMETHOXYETHANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 16% NaCl 67 mM	Resolution 2.74 Å R-free 0.214
5K8V Crystal Structure of Mus musculus Protein Arginine Methyltransferase 4 (CARM1 130-487) with CP1 Deposited 2016-05-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6RE [[2-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]ethylamino]-azanyl-methylidene]azanium × 4 DXE 1,2-DIMETHOXYETHANE × 1 EDO 1,2-ETHANEDIOL × 10 PEG DI(HYDROXYETHYL)ETHER × 2 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM, PEG 2000 MME 15 %, NaCl 100 mM	Resolution 2.25 Å R-free 0.235
5K8W Crystal structure of mouse CARM1 in complex with inhibitor U2 Deposited 2016-05-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	GJV 9-(7-{[amino(iminio)methyl]amino}-5,6,7-trideoxy-beta-D-ribo-heptofuranosyl)-9H-purin-6-amine × 4 DXE 1,2-DIMETHOXYETHANE × 6 EDO 1,2-ETHANEDIOL × 9 PG4 TETRAETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM, PEG 2000 MME 15 %	Resolution 2.10 Å R-free 0.240
5K8X Crystal structure of mouse CARM1 in complex with inhibitor U3 Deposited 2016-05-31	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	6ZH [[[(~{E})-3-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]prop-2-enyl]amino]-azanyl-methylidene]azanium × 4 EDO 1,2-ETHANEDIOL × 14 PEG DI(HYDROXYETHYL)ETHER × 5 PG4 TETRAETHYLENE GLYCOL × 1 PE8 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL × 1 DXE 1,2-DIMETHOXYETHANE × 6 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM, PEG 2000 MME 15 %, NaCl 100 mM	Resolution 1.99 Å R-free 0.211
5LGP Crystal structure of mouse CARM1 in complex with ligand P1C3s Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 5 8ZB (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-propyl-oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris-HCl pH 8.5 16% PEG 3350 200 mM A.S.	Resolution 2.04 Å R-free 0.219
5LGQ Crystal structure of mouse CARM1 in complex with ligand P2C3s Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 7 PEG DI(HYDROXYETHYL)ETHER × 4 DXE 1,2-DIMETHOXYETHANE × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1 SO4 SULFATE ION × 1 8ZB (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-propyl-oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；100 mM Tris-HCl pH 8.5 14% PEG 3350 200 mM A.S.	Resolution 2.11 Å R-free 0.236
5LGR Crystal structure of mouse CARM1 in complex with ligand P1C3u Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	SO4 SULFATE ION × 1 EDO 1,2-ETHANEDIOL × 6 DXE 1,2-DIMETHOXYETHANE × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1 PEG DI(HYDROXYETHYL)ETHER × 1 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4 LPD L-PROLINAMIDE × 4 ACE ACETYL GROUP × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；Tris-HCl pH 8.5 100 mM PEG 3350 14 % Ammonium Sulfate 200 mM	Resolution 2.00 Å R-free 0.234
5LGS Crystal structure of mouse CARM1 in complex with ligand P2C3u Deposited 2016-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	SO4 SULFATE ION × 1 DXE 1,2-DIMETHOXYETHANE × 3 PEG DI(HYDROXYETHYL)ETHER × 1 PG4 TETRAETHYLENE GLYCOL × 1 EDO 1,2-ETHANEDIOL × 3 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.5 100 mM PEG 3350 20 % A.S. 200 mM	Resolution 2.10 Å R-free 0.215
5LKJ Crystal structure of mouse CARM1 in complex with ligand SA684 Deposited 2016-07-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–497（368 aa） Chain B 130–497（368 aa） Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	6YB (2~{S})-4-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-(2-carbamimidamidoethyl)amino]-2-azanyl-butanoic acid × 4 EDO 1,2-ETHANEDIOL × 8 DXE 1,2-DIMETHOXYETHANE × 5 PEG DI(HYDROXYETHYL)ETHER × 3 P33 3,6,9,12,15,18-HEXAOXAICOSANE-1,20-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；297 K；100 mM BTP pH 7.5 30% PEG 1500	Resolution 2.60 Å R-free 0.220
5LV2 Crystal structure of mouse CARM1 in complex with inhibitor LH1246 Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 2 EDO 1,2-ETHANEDIOL × 5 LHB 5-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methylamino]methyl]-4-azanyl-1-(methoxymethyl)pyrimidin-2-one × 2 PG4 TETRAETHYLENE GLYCOL × 2 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 DXE 1,2-DIMETHOXYETHANE × 1 PEG DI(HYDROXYETHYL)ETHER × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 17 % NaCl 100 mM	Resolution 2.29 Å R-free 0.238
5LV2 Crystal structure of mouse CARM1 in complex with inhibitor LH1246 Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 130–487（358 aa） Chain F 130–487（358 aa） Chain G 130–487（358 aa） Chain H 130–487（358 aa）	Not recorded	SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 2 EDO 1,2-ETHANEDIOL × 8 LHB 5-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methylamino]methyl]-4-azanyl-1-(methoxymethyl)pyrimidin-2-one × 2 PG4 TETRAETHYLENE GLYCOL × 2 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 17 % NaCl 100 mM	Resolution 2.29 Å R-free 0.238
5LV3 Crystal structure of mouse CARM1 in complex with ligand LH1561Br Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	SAH S-ADENOSYL-L-HOMOCYSTEINE × 2 LHF 5-[[2-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]ethylamino]methyl]-4-azanyl-1-[2-(4-bromanylphenoxy)ethyl]pyrimidin-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；297 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 15% NaCl 100 mM	Resolution 1.80 Å R-free 0.203
5NTC Crystal structure of mouse CARM1 in complex with inhibitor SA0678 Deposited 2017-04-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–497（368 aa） Chain B 130–497（368 aa） Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 13 PEG DI(HYDROXYETHYL)ETHER × 2 DXE 1,2-DIMETHOXYETHANE × 2 M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 B3P 2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 3 6L7 [(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-(2-azaniumylethyl)-[(3~{S})-3-azaniumyl-4-oxidanyl-4-oxidanylidene-butyl]azanium × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；297 K；BTP pH 7.5 100 mM, PEG 2000 MME 25 %, NaCl 50 mM	Resolution 2.25 Å R-free 0.216
5TBH Crystal structure of mouse CARM1 in complex with inhibitor LH1236 Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	M2M 1-METHOXY-2-(2-METHOXYETHOXY)ETHANE × 1 EDO 1,2-ETHANEDIOL × 17 PG4 TETRAETHYLENE GLYCOL × 1 SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 2 78K (2~{R})-4-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl-[[4-azanyl-1-(methoxymethyl)-2-oxidanylidene-pyrimidin-5-yl]methyl]amino]-2-azanyl-butanoic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 19% NaCl 100 mM	Resolution 2.34 Å R-free 0.230
5TBI Crystal structure of mouse CARM1 in complex with inhibitor LH1427 Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Fragment：UNP residues 130-487 Chain B 130–487（358 aa） Fragment：UNP residues 130-487 Chain C 130–487（358 aa） Fragment：UNP residues 130-487 Chain D 130–487（358 aa） Fragment：UNP residues 130-487	Not recorded	EDO 1,2-ETHANEDIOL × 17 SAO 5'-S-[(3S)-3-azaniumyl-3-carboxypropyl]-5'-thioadenosine × 2 PE8 3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL × 1 78V 4-[2-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methylamino]ethylamino]-1-(methoxymethyl)pyrimidin-2-one × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 21% NaCl 100 mM	Resolution 2.29 Å R-free 0.228
5TBJ Crystal structure of mouse CARM1 in complex with inhibitor LH1452 Deposited 2016-09-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	LHD 2-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]ethyl-[[4-azanyl-1-(methoxymethyl)-2-oxidanylidene-pyrimidin-5-yl]methyl]azanium × 4 PEG DI(HYDROXYETHYL)ETHER × 4 EDO 1,2-ETHANEDIOL × 11 DXE 1,2-DIMETHOXYETHANE × 1 PG6 1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Tris-HCl pH 8.0 100 mM PEG 2000 MME 19% NaCl 100 mM	Resolution 2.32 Å R-free 0.237
7OKP Crystal structure of mouse CARM1 in complex with histone H3_13-22 K18 acetylated Deposited 2021-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–497（368 aa） Chain B 130–497（368 aa）	Not recorded	MLI MALONATE ION × 2 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1M sodium malonate, 0.1M MES pH7.0, 0.2M sodium chloride	Resolution 2.20 Å R-free 0.254
7OKP Crystal structure of mouse CARM1 in complex with histone H3_13-22 K18 acetylated Deposited 2021-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	MLI MALONATE ION × 8 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1M sodium malonate, 0.1M MES pH7.0, 0.2M sodium chloride	Resolution 2.20 Å R-free 0.254
7OS4 Crystal structure of mouse CARM1 in complex with histone H3_13-31 K18 Deposited 2021-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–497（368 aa） Chain B 130–497（368 aa）	Not recorded	QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.2M Sodium malonate 0.1M MES pH 5.5 0.2M NaCl	Resolution 2.54 Å R-free 0.255
7OS4 Crystal structure of mouse CARM1 in complex with histone H3_13-31 K18 Deposited 2021-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；1.2M Sodium malonate 0.1M MES pH 5.5 0.2M NaCl	Resolution 2.54 Å R-free 0.255
7PPQ CARM1 in complex with EML736 Deposited 2021-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	LSK methyl 6-[5-[[~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]carbamimidoyl]amino]pentylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；15% PEG 2000, 0.1M sodium chloride, 0.1M tris-HCl	Resolution 2.10 Å R-free 0.228
7PPY CARM1 in complex with EML709 Deposited 2021-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	7ZH methyl 6-[4-[[~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]carbamimidoyl]amino]butylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；12% PEG 2000, 100mM NaCl, 100mM TrisHCl pH8	Resolution 2.42 Å R-free 0.235
7PU8 CARM1 in complex with EML980 Deposited 2021-09-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	4R7 methyl 6-[4-[[N-[2-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]ethyl]carbamimidoyl]amino]butylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；15% PEG 2000, 0.1M Sodium Chloride, 0.1M Tris HCl	Resolution 2.19 Å R-free 0.229
7PUC CARM1 in complex with EML981 Deposited 2021-09-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	85U methyl 6-[4-[[~{N}-[(~{E})-3-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]prop-2-enyl]carbamimidoyl]amino]butylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；15% PEG 3350, 200mM AMMONIUM SULFATE, 100mM TRIS HCL pH8.5	Resolution 2.19 Å R-free 0.231
7PUQ CARM1 in complex with EML982 Deposited 2021-09-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–486（357 aa） Chain B 130–486（357 aa） Chain C 130–486（357 aa） Chain D 130–486（357 aa）	Not recorded	867 methyl 6-[4-[[~{N}-[3-[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]carbamimidoyl]amino]butylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；12% PEG 3350, 0.1 M NaCl, 0.1 M TrisHCl pH8.5	Resolution 2.09 Å R-free 0.217
7PV6 CARM1 in complex with EML734 Deposited 2021-10-01	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 130–497（368 aa） Chain B 130–497（368 aa）	Not recorded	LRZ methyl 6-[3-[[~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]carbamimidoyl]amino]propylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20 mM Tris pH 7.5, 50 mM NaCl, 1 mM TCEP	Resolution 2.40 Å R-free 0.237
7PV6 CARM1 in complex with EML734 Deposited 2021-10-01	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	LRZ methyl 6-[3-[[~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]carbamimidoyl]amino]propylcarbamoylamino]-4-oxidanyl-naphthalene-2-carboxylate × 4 EDO 1,2-ETHANEDIOL × 6 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20 mM Tris pH 7.5, 50 mM NaCl, 1 mM TCEP	Resolution 2.40 Å R-free 0.237
7QPH Crystal structure of mouse CARM1 in complex with histone H3_22-31 K27 acetylated Deposited 2022-01-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 130–487（358 aa） Chain B 130–487（358 aa） Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；16% PEG 3350, 0.2M ammonium sulfate, 0.1M Tris HCl pH8.5	Resolution 1.90 Å R-free 0.210
7QRD Crystal structure of mouse CARM1 in complex with histone H3_10-25 Deposited 2022-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 130–507（378 aa） Chain B 130–507（378 aa） Chain C 130–507（378 aa） Chain D 130–507（378 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 MLI MALONATE ION × 2 SAH S-ADENOSYL-L-HOMOCYSTEINE × 2 QVR (2~{R},3~{R},4~{S},5~{R})-2-(6-aminopurin-9-yl)-5-[(~{E})-prop-1-enyl]oxolane-3,4-diol × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；20 mM Tris-HCl pH 7.5 50 mM NaCl 1 mM TCEP	Resolution 2.00 Å R-free 0.254
9I0A CARM1 in complex with arg-aDMA analog Deposited 2025-01-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 130–487（358 aa） Chain B 130–487（358 aa）	Not recorded	A1IZI (phenylmethyl) (2S)-5-[[N-[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]-N-methyl-carbamimidoyl]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% PEG3350, 100 mM tris pH7.5, 0.1M NaCl	Resolution 2.22 Å R-free 0.237
9I0A CARM1 in complex with arg-aDMA analog Deposited 2025-01-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	A1IZI (phenylmethyl) (2S)-5-[[N-[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]-N-methyl-carbamimidoyl]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；10% PEG3350, 100 mM tris pH7.5, 0.1M NaCl	Resolution 2.22 Å R-free 0.237
9I1T CARM1 in complex with arg-MMA analog Deposited 2025-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 130–487（358 aa） Chain B 130–487（358 aa）	Not recorded	A1IZ2 (phenylmethyl) (2S)-5-[[N-[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]carbamimidoyl]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；9% PEG3350, 100mM Tris HCl pH7.5, 0.2M ammonium sulfate	Resolution 2.39 Å R-free 0.238
9I1T CARM1 in complex with arg-MMA analog Deposited 2025-01-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 130–487（358 aa） Chain D 130–487（358 aa）	Not recorded	A1IZ2 (phenylmethyl) (2S)-5-[[N-[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]carbamimidoyl]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；9% PEG3350, 100mM Tris HCl pH7.5, 0.2M ammonium sulfate	Resolution 2.39 Å R-free 0.238
9I9U CARM1 in complex with arg-sDMA analog Deposited 2025-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 130–497（368 aa） Chain B 130–497（368 aa）	Not recorded	A1I1H (phenylmethyl) (2S)-5-[(Z)-[[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propylamino]-(methylamino)methylidene]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；12% PEG6000, 100 mM hepes pH7	Resolution 2.20 Å R-free 0.245
9I9U CARM1 in complex with arg-sDMA analog Deposited 2025-02-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 130–497（368 aa） Chain D 130–497（368 aa）	Not recorded	A1I1H (phenylmethyl) (2S)-5-[(Z)-[[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propylamino]-(methylamino)methylidene]amino]-2-(phenylmethoxycarbonylamino)pentanoate × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；12% PEG6000, 100 mM hepes pH7	Resolution 2.20 Å R-free 0.245

42 other PDB entries and 50 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CARM1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 3–346； UniProt 147–490 Author chain D； PDBConstruct 3–346； UniProt 147–490 Author chain F； PDBConstruct 3–346； UniProt 147–490 Author chain H； PDBConstruct 3–346； UniProt 147–490

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2v74
Deposition date deposition_date	2007-07-26
Structure title title	Crystal structure of coactivator-associated arginine methyltransferase 1 (CARM1), in complex with S-adenosyl-homocysteine
Keywords keywords	;ARGININE METHYLTRANSFERASE, S-ADENOSYL-L-METHIONINE, TRANSCRIPTION REGULATION, ALTERNATIVE SPLICING, HISTONE MODIFICATION, CO- ACTIVATOR, METHYLTRANSFERASE, CHROMATIN REGULATOR, NUCLEUS, CYTOPLASM, TRANSFERASE, TRANSCRIPTION ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.81 Å
Radius of gyration Rg (electron density) rg_electron	39.52 Å
Forward intensity I(0) i0	316748000.00
Molecular weight molecular_weight	149720.0 kDa
Excluded volume excluded_volume	188760 Å³
Envelope volume envelope_volume	239560 Å³
Hydration-shell volume shell_volume	51111 Å³
Envelope diameter envelope_diameter	132.2 Å
Shell Rg shell_rg	44.55 Å
Envelope Rg envelope_rg	38.71 Å
Shape Rg shape_rg	39.48 Å
Total Rg total_rg	39.94 Å
Total atoms total_atoms	10571
Residues n_residues	1326
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	128.4 Å
Rg (real space) rg_real	39.80 Å
Rg uncertainty (real space) rg_real_error	1.01 Å
I(0) (real space) i0_real	3.1670e+08
I(0) uncertainty (real space) i0_real_error	5.4490e+06
Rg (reciprocal space) rg_reciprocal	39.81 Å
I(0) (reciprocal space) i0_reciprocal	316800000.0000
Solution quality estimate total_estimate	0.8986
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	48.2 Å
Skewness Skewness skewness	0.246
Kurtosis Kurtosis kurtosis	-0.613
Angular range angular_range	— – 0.2000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	34870000.0000
Real-space data points n_real_points	41
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.941; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.984; Smooth: 0.870

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	HISTONE-ARGININE METHYLTRANSFERASE CARM1
Molecular weight formula_weight	39104.6 kDa
EC 编号 ec_number	2.1.1.125
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H
Atom count atom_count	10832

GAAVQYFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQAGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLPEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSGNMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHY

来源 Source

来源生物 organism	MUS MUSCULUS
通用名 common_name	MOUSE
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	SPODOPTERA FRUGIPERDA

Entity 2 Entity 2 non-polymer

Description description	S-ADENOSYL-L-HOMOCYSTEINE
Molecular weight formula_weight	384.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	261

▼

7. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2v74b_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.66 — S-adenosyl-L-methionine-dependent methyltransferases
Superfamily Superfamily superfamily	c.66.1 — S-adenosyl-L-methionine-dependent methyltransferases
Family Family family	c.66.1.6 — Arginine methyltransferase

Domain ID domain_id	d2v74d_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.66 — S-adenosyl-L-methionine-dependent methyltransferases
Superfamily Superfamily superfamily	c.66.1 — S-adenosyl-L-methionine-dependent methyltransferases
Family Family family	c.66.1.6 — Arginine methyltransferase

Domain ID domain_id	d2v74f_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.66 — S-adenosyl-L-methionine-dependent methyltransferases
Superfamily Superfamily superfamily	c.66.1 — S-adenosyl-L-methionine-dependent methyltransferases
Family Family family	c.66.1.6 — Arginine methyltransferase

Domain ID domain_id	d2v74h_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.66 — S-adenosyl-L-methionine-dependent methyltransferases
Superfamily Superfamily superfamily	c.66.1 — S-adenosyl-L-methionine-dependent methyltransferases
Family Family family	c.66.1.6 — Arginine methyltransferase

CATH v4.4 (8 domains)

Domain ID domain_id	2v74B01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	150 — Vaccinia Virus protein VP39

Domain ID domain_id	2v74B02
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	160 — Hnrnp arginine n-methyltransferase1
Homologous superfamily homologous superfamily	11 — Hnrnp arginine n-methyltransferase1

Domain ID domain_id	2v74D01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	150 — Vaccinia Virus protein VP39

Domain ID domain_id	2v74D02
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	160 — Hnrnp arginine n-methyltransferase1
Homologous superfamily homologous superfamily	11 — Hnrnp arginine n-methyltransferase1

Domain ID domain_id	2v74F01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	150 — Vaccinia Virus protein VP39

Domain ID domain_id	2v74F02
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	160 — Hnrnp arginine n-methyltransferase1
Homologous superfamily homologous superfamily	11 — Hnrnp arginine n-methyltransferase1

Domain ID domain_id	2v74H01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	150 — Vaccinia Virus protein VP39

Domain ID domain_id	2v74H02
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	160 — Hnrnp arginine n-methyltransferase1
Homologous superfamily homologous superfamily	11 — Hnrnp arginine n-methyltransferase1

▶

8. Citations (1)

▶

Unit-cell length a length_a	74.879 Å
Unit-cell length b length_b	98.691 Å
Unit-cell length c length_c	207.224 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2260
R_work r_work	0.2230
R_free r_free	0.2730

fit	/app/data/saxs_computation/v7/2v74/2v74.fit
pddf	/app/data/pr_computation/v7/2v74/2v74.pr.out
profile	/app/data/saxs_computation/v7/2v74/2v74.dat