SAXSdb — 2vwa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012

PLASMODIUM FALCIPARUM

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	PHOSPHATIDYLETHANOLAMINE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8IEU1_PLAF7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–101； UniProt 129–229 Author chain B； PDBConstruct 1–101； UniProt 129–229 Author chain C； PDBConstruct 1–101； UniProt 129–229 Author chain D； PDBConstruct 1–101； UniProt 129–229 Author chain E； PDBConstruct 1–101； UniProt 129–229 Author chain F； PDBConstruct 1–101； UniProt 129–229

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2vwa
Deposition date deposition_date	2008-06-20
Structure title title	Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite
Keywords keywords	UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2vwa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2vwa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2vwa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.15 Å
Rg (electron density)	14.05 Å
Total Rg	15.16 Å
Atom count	884
Residues	97
Excluded volume	15889 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2vwa__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2vwa__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2vwa__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2vwa__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2vwa__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2vwa__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012
Molecular weight formula_weight	12229.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	5439

INKINLNKPIIENKNNVDVSIKRYNNFVDIARLSIQKHFEHLSNDQKDSHVNNMEYMQKFVQGLQENRNISLSKYQENKAVMDLKYHLQKVYANYLSQEEN

Source Source

Source organism organism	PLASMODIUM FALCIPARUM
Common name common_name	MALARIA PARASITE
NCBI taxonomy ID ncbi_taxonomy_id	36329
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	734.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	135

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	2vwaA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

Domain ID domain_id	2vwaB00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

Domain ID domain_id	2vwaC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

Domain ID domain_id	2vwaD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

Domain ID domain_id	2vwaE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

Domain ID domain_id	2vwaF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1330 — Plasmodium falciparum UIS3 membrane protein

▶

Unit-cell length a length_a	82.544 Å
Unit-cell length b length_b	38.274 Å
Unit-cell length c length_c	145.696 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.25 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	25.000 Å
R factor r_factor	0.2230
R_work r_work	0.2200
R_free r_free	0.2710

Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vwa__assembly_1__model_1

2vwa__assembly_1__model_1 | I(q)

2vwa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of a sporozoite protein essential for liver stage development of malaria parasite

1. Protein Identity and Related Structures Protein Identity & Related Structures

PUTATIVE UNCHARACTERIZED PROTEIN PF13_0012

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2vwa__assembly_1__model_1

2vwa__assembly_1__model_1 | I(q)

2vwa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)