2xsj

Structure of desulforubidin from Desulfomicrobium norvegicum

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE REDUCTASE ALPHA SUBUNIT

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	SULFITE REDUCTASE BETA SUBUNIT × 2 （Q93UT0） SULFUR RELAY PROTEIN, TUSE/DSRC/DSVC FAMILY × 2 IRON/SULFUR CLUSTER × 8 SIROHEME × 4 SULFITE ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93UT1_DESNO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 63–437； UniProt 1–375 Author chain D； PDBConstruct 63–437； UniProt 1–375

SULFITE REDUCTASE BETA SUBUNIT

OrganismNot specified

UniProt Q93UT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	SULFITE REDUCTASE ALPHA SUBUNIT × 2 （Q93UT1） SULFUR RELAY PROTEIN, TUSE/DSRC/DSVC FAMILY × 2 IRON/SULFUR CLUSTER × 8 SIROHEME × 4 SULFITE ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q93UT0_DESNO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–271； UniProt 1–271 Author chain E； PDBConstruct 1–271； UniProt 1–271

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2xsj
Deposition date deposition_date	2010-09-29
Structure title title	Structure of desulforubidin from Desulfomicrobium norvegicum
Keywords keywords	DISSIMILATORY SULFITE REDUCTASE, SULFUR METABOLISM, DSRABC, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2xsj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2xsj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2xsj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.16 Å
Rg (electron density)	37.78 Å
Total Rg	37.85 Å
Atom count	14938
Residues	1850
Excluded volume	265430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2xsj__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	SULFITE REDUCTASE ALPHA SUBUNIT
Molecular weight formula_weight	49398.9 kDa
EC 编号 ec_number	1.8.99.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	15979

MAKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR

Entity 2 Entity 2 polymer

Description description	SULFITE REDUCTASE BETA SUBUNIT
Molecular weight formula_weight	43335.9 kDa
EC 编号 ec_number	1.8.99.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

MAFVSSGYNPEKPMENRISDIGPRHASDFFPPVIAKNKGQWLWHEICEPGILMHKAESGDEVYTVRCGGARLMSVGHIREICAIADKFCGGHLRFTTRNNIEFMVTTLDEAKKLKEYLNAQKFEGGSFKFPVGGTGAGITNIVHTQGWVHCHTPATDASGTVKVVLDELFEEFGQMRMPAQVRISMACCLNMCGAVHCSDIAILGYHRKPPVIDHEWLDNLCEIPLAVAACPVGAIRPTKKEIVTEKGETKTVNTVAIKNERCMFCGNCYTMCPSLPLSDQTGDGLVIMAGGKVSNRISNPKFSKVVVAFIPNEPPRWPRLASVIRQIVEAYAADARKYERVGDWAERIGWERFFEKCELDFSIHMIDDFRDPAYYTWRQTTNFKF

Entity 3 Entity 3 polymer

Description description	SULFUR RELAY PROTEIN, TUSE/DSRC/DSVC FAMILY
Molecular weight formula_weight	11858.6 kDa
EC 编号 ec_number	1.8.99.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F

MAMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV

Entity 4 Entity 4 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	SIROHEME
Molecular weight formula_weight	916.7 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	SULFITE ION
Molecular weight formula_weight	80.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1041

▼

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2xsjc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.203 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Superfamily Superfamily superfamily	d.203.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Family Family family	d.203.1.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase

Domain ID domain_id	d2xsjf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.203 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Superfamily Superfamily superfamily	d.203.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase
Family Family family	d.203.1.1 — DsrC, the gamma subunit of dissimilatory sulfite reductase

CATH v4.4 (18 domains)

Domain ID domain_id	2xsjA01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	1420 —

Domain ID domain_id	2xsjA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	2500 —

Domain ID domain_id	2xsjA03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	413 — Sulfite Reductase Hemoprotein; domain 1
Homologous superfamily homologous superfamily	10 — Sulfite Reductase Hemoprotein, domain 1

Domain ID domain_id	2xsjA04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2xsjB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3340 —

Domain ID domain_id	2xsjB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	413 — Sulfite Reductase Hemoprotein; domain 1
Homologous superfamily homologous superfamily	10 — Sulfite Reductase Hemoprotein, domain 1

Domain ID domain_id	2xsjB03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2xsjC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1420 — Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — DsrC protein, N-terminal domain

Domain ID domain_id	2xsjC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	370 — DsrC protein, C-terminal domain

Domain ID domain_id	2xsjD01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	1420 —

Domain ID domain_id	2xsjD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	2500 —

Domain ID domain_id	2xsjD03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	413 — Sulfite Reductase Hemoprotein; domain 1
Homologous superfamily homologous superfamily	10 — Sulfite Reductase Hemoprotein, domain 1

Domain ID domain_id	2xsjD04
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2xsjE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3340 —

Domain ID domain_id	2xsjE02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	413 — Sulfite Reductase Hemoprotein; domain 1
Homologous superfamily homologous superfamily	10 — Sulfite Reductase Hemoprotein, domain 1

Domain ID domain_id	2xsjE03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	2xsjF01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1420 — Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — DsrC protein, N-terminal domain

Domain ID domain_id	2xsjF02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	370 — DsrC protein, C-terminal domain

▶

Unit-cell length a length_a	99.340 Å
Unit-cell length b length_b	135.090 Å
Unit-cell length c length_c	178.030 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	44.510 Å
R factor r_factor	0.1588
R_work r_work	0.1562
R_free r_free	0.2085

Structure of desulforubidin from Desulfomicrobium norvegicum

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE REDUCTASE ALPHA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

SULFITE REDUCTASE BETA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2xsj__assembly_1__model_1

2xsj__assembly_1__model_1 | I(q)

2xsj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (2 domains)

CATH v4.4 (18 domains)

7. Citations (1)

Structure of desulforubidin from Desulfomicrobium norvegicum

1. Protein Identity and Related Structures Protein Identity & Related Structures

SULFITE REDUCTASE ALPHA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SULFITE REDUCTASE BETA SUBUNIT

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2xsj__assembly_1__model_1

2xsj__assembly_1__model_1 | I(q)

2xsj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (2 domains)

CATH v4.4 (18 domains)

7. Citations (1)