SAXSdb — 2y9y

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)

SACCHAROMYCES CEREVISIAE

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 763–1129	Fragment：HAND, SANT, SLIDE DOMAINS, RESIDUES 763-1129 Mutation：YES	ISWI ONE COMPLEX PROTEIN 3 × 1 （P43596）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6.5；100MM BISTRIS, PH 7.0, 1.6M NA-CITRATE, 10% GLYCEROL, 0.1M NA PHOSPHATE.	Resolution 3.25 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2Y9Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2Y9Z Chromatin Remodeling Factor ISW1a(del_ATPase) in DNA complex Deposited 2011-02-17	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: hexameric	Chain A 763–1129（367 aa） Fragment：HAND, SANT, SLIDE DOMAINS, RESIDUES 763-1129	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；50MM BISTRIS(PH7.0), 150MM NACITRATE, 30%(W/V) PEG5000	Resolution 3.60 Å R-free 0.291
6IRO the crosslinked complex of ISWI-nucleosome in the ADP-bound state Deposited 2018-11-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain L 69–1129（1061 aa）	Mutation：D483K	ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6JYL The crosslinked complex of ISWI-nucleosome in the ADP.BeF-bound state Deposited 2019-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE；blot 1.5s	Resolution 3.37 Å
6K1P The complex of ISWI-nucleosome in the ADP.BeF-bound state Deposited 2019-05-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	BEF BERYLLIUM TRIFLUORIDE ION × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5；10 mM Tris, 50 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE；blot for 1.5s	Resolution 3.87 Å
7X3T Cryo-EM structure of ISW1a-dinucleosome Deposited 2022-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 20-meric	Chain V 69–1129（1061 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
7X3W Cryo-EM structure of ISW1-N1 nucleosome Deposited 2022-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain K 69–1129（1061 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7X3X Cryo-EM structure of N1 nucleosome-RA Deposited 2022-03-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain V 69–1129（1061 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9JNP Structure of isw1-nucleosome complex in ATP state Deposited 2024-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.30 Å
9JNT Structure of isw1-nucleosome complex in ADP* state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9JNU Structure of isw1-nucleosome complex in ADP state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9JNV Structure of isw1-nucleosome complex in ADP(S) state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9JNW Structure of isw1-nucleosome complex in ADP+ state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9JNX Structure of isw1-nucleosome complex in ADP*+ state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9JNZ Structure of isw1-nucleosome complex in Apo state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9JO2 Structure of isw1-nucleosome complex in Apo* state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	CL CHLORIDE ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9JO5 Structure of isw1-nucleosome complex in ADP-B state Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9LIU Structure of isw1-nucleosome double-bound complex in ATP-ATP state Deposited 2025-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain K 69–1129（1061 aa） Chain N 69–1129（1061 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9LJ2 Structure of isw1-nucleosome double-bound complex in ADP-ADP+ state Deposited 2025-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain K 1–1129（1129 aa） Chain N 1–1129（1129 aa）	Not recorded	MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å

18 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ISW1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–368； UniProt 763–1129

ISWI ONE COMPLEX PROTEIN 3

SACCHAROMYCES CEREVISIAE

UniProt P43596

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 127–749	Fragment：CORE DOMAIN CONTAINING CLB AND HLB SUBDOMAINS, RESIDUES 127-749 Mutation：YES	IMITATION SWITCH PROTEIN 1 (DEL_ATPASE) × 1 （P38144）	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6.5；100MM BISTRIS, PH 7.0, 1.6M NA-CITRATE, 10% GLYCEROL, 0.1M NA PHOSPHATE.	Resolution 3.25 Å R-free 0.296

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2Y9Y	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2Y9Z Chromatin Remodeling Factor ISW1a(del_ATPase) in DNA complex Deposited 2011-02-17	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 2 PDB declaration: hexameric	Chain B 127–749（623 aa） Fragment：CORE DOMAIN CONTAINING CLB AND HLB SUBDOMAINS, RESIDUES 127-749	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；50MM BISTRIS(PH7.0), 150MM NACITRATE, 30%(W/V) PEG5000	Resolution 3.60 Å R-free 0.291
7X3T Cryo-EM structure of ISW1a-dinucleosome Deposited 2022-03-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 20-meric	Chain U 127–749（623 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.40 Å
7X3V Cryo-EM structure of IOC3-N2 nucleosome Deposited 2022-03-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain U 127–749（623 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IOC3_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–624； UniProt 127–749

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2y9y
Deposition date deposition_date	2011-02-17
Structure title title	Chromatin Remodeling Factor ISW1a(del_ATPase)
Keywords keywords	TRANSCRIPTION, NUCLEAR PROTEIN COMPLEX, CHROMATIN REMODELING, NUCLEOSOME REMODELING; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	38.71 Å
Radius of gyration Rg (electron density) rg_electron	39.11 Å
Forward intensity I(0) i0	152544000.00
Molecular weight molecular_weight	101550.0 kDa
Excluded volume excluded_volume	128160 Å³
Envelope volume envelope_volume	192250 Å³
Hydration-shell volume shell_volume	43890 Å³
Envelope diameter envelope_diameter	147.2 Å
Shell Rg shell_rg	40.80 Å
Envelope Rg envelope_rg	41.37 Å
Shape Rg shape_rg	39.05 Å
Total Rg total_rg	39.45 Å
Total atoms total_atoms	7170
Residues n_residues	869
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	140.3 Å
Rg (real space) rg_real	39.45 Å
Rg uncertainty (real space) rg_real_error	1.66 Å
I(0) (real space) i0_real	1.5250e+08
I(0) uncertainty (real space) i0_real_error	2.9430e+06
Rg (reciprocal space) rg_reciprocal	38.99 Å
I(0) (reciprocal space) i0_reciprocal	152500000.0000
Solution quality estimate total_estimate	0.7662
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	37.6 Å
Skewness Skewness skewness	0.733
Kurtosis Kurtosis kurtosis	0.003
Angular range angular_range	— – 0.2050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	21760000.0000
Real-space data points n_real_points	42
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.524; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.672; Smooth: 0.714

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
Molecular weight formula_weight	44339.9 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7170

MLLNPTKRERKENYSIDNYYKDVLNTGRSSTPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDATKDRMKKEDENGKRIREEFADQTANEKENVDGVESKKAKIEDTSNVGTEQLVAEKIPENETTHHHHHHH

来源 Source

来源生物 organism	SACCHAROMYCES CEREVISIAE
通用名 common_name	;BAKER'S YEAST ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	SPODOPTERA FRUGIPERDA

Entity 2 Entity 2 polymer

Description description	ISWI ONE COMPLEX PROTEIN 3
Molecular weight formula_weight	72437.6 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MVAPKPKPAHEQVEPALIPSNWTSVIPLLTSDFKNQYSVISRLKNPNMKPVPYAGDIIKLMAFINKFSSFFHSDLQNLSFQDFEVGLDLYPGDPNGSAAGIVKGPEDTSLLLYPDFMAIKDIVYCQDKMNLLFLSLLDLTFTENFDGKSAKKKGPLTTWENLKSSSKKVFSNPLYRLRLVAREWGYPREWRQQLPSDQDISKPKTALFEQDEQTPVVDPSHPEILTPNIYTWNANEPLPLESNPLYNREMDKNGILALKPMDRVVLLRALTDWCASHSSAIHDEIYKLTHGKKDPVFGIQTQQVPRYTIEGVDNTINQFKKLCSLIQSRYEIRSKKKHFVKQLKEGKKPDLSRKLEILKEIKAELKNAVKSEKDELLFSLYDKWVPLFEGELPDQPLANPFSERLYKLRLQEFFLGRVPHIGDFYMPRLHSYGDSLEMSTFTDLRNLQALLSKFKNNEYNAFTLFENDGQSMSAQFKLFYHDTPSLAHDVARGRNTSGKVYWYELCHDSATLLEFLEFLDYKIVKPQDEKKEGNEKEKEALNNEAHILEQKSTTDNKPSINTNPLPKDAKYNTARKKLQILKEFLSDYYFILRQFEQMKVQFADMKPGKRQLRRIQRQTVNYNT

来源 Source

来源生物 organism	SACCHAROMYCES CEREVISIAE
通用名 common_name	;BAKER'S YEAST ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	SPODOPTERA FRUGIPERDA

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	2y9yA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1040 — N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
Homologous superfamily homologous superfamily	30 — ISWI, HAND domain

Domain ID domain_id	2y9yA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	2y9yA03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1190 — iswi atpase

Domain ID domain_id	2y9yA04
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	206.971 Å
Unit-cell length b length_b	206.971 Å
Unit-cell length c length_c	215.308 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	3.250 Å
Low-resolution limit resolution_low	29.874 Å
R factor r_factor	0.2838
R_work r_work	0.2832
R_free r_free	0.2965

fit	/app/data/saxs_computation/y9/2y9y/2y9y.fit
pddf	/app/data/pr_computation/y9/2y9y/2y9y.pr.out
profile	/app/data/saxs_computation/y9/2y9y/2y9y.dat

Chromatin Remodeling Factor ISW1a(del_ATPase)

1. Protein Identity and Related Structures Protein Identity & Related Structures

IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)

State in the Current Structure

Other States of the Same Protein in the Database

ISWI ONE COMPLEX PROTEIN 3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)