2zqk

Crystal structure of intimin-Tir68 complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Putative translocated intimin receptor protein (Translocated intimin receptor Tir) × 2 （Q7DB77）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Putative translocated intimin receptor protein (Translocated intimin receptor Tir) × 2 （Q7DB77）	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	No other associated polymer	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EAE_ECO57
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–189； UniProt 747–934 Author chain B； PDBConstruct 2–189； UniProt 747–934

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

Escherichia coli

UniProt Q7DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Intimin × 1 （P43261）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Intimin × 1 （P43261）	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	No other associated polymer	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DB77_ECO57
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–69； UniProt 269–336 Author chain D； PDBConstruct 2–69； UniProt 269–336 Author chain M； PDBConstruct 2–69； UniProt 269–336 Author chain N； PDBConstruct 2–69； UniProt 269–336

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zqk
Deposition date deposition_date	2008-08-12
Structure title title	Crystal structure of intimin-Tir68 complex
Keywords keywords	;protein-protein complex, unique intimin-Tir trimer intermediate, Cell membrane, Cell outer membrane, Membrane, Transmembrane, Virulence, Receptor, Cell Adhesion ;; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2zqk__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2zqk__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2zqk__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.83 Å
Rg (electron density)	19.24 Å
Total Rg	19.93 Å
Atom count	1417
Residues	184
Excluded volume	25169 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zqk__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2zqk__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2zqk__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2zqk__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2zqk__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2zqk__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Intimin
Molecular weight formula_weight	20673.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4739

MATEVTFFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	83334
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
Molecular weight formula_weight	8404.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,C,D

MDAAASATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENLEHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	83334
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2zqka1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.14 — Invasin/intimin cell-adhesion fragments
Family Family family	b.1.14.0 — automated matches

Domain ID domain_id	d2zqka2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.0 — automated matches

Domain ID domain_id	d2zqkb1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.14 — Invasin/intimin cell-adhesion fragments
Family Family family	b.1.14.0 — automated matches

Domain ID domain_id	d2zqkb2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.0 — automated matches

CATH v4.4 (8 domains)

Domain ID domain_id	2zqkA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1080 —

Domain ID domain_id	2zqkA02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	2zqkB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1080 —

Domain ID domain_id	2zqkB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	2zqkC00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

Domain ID domain_id	2zqkD00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

Domain ID domain_id	2zqkM00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

Domain ID domain_id	2zqkN00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

▶

Unit-cell length a length_a	116.680 Å
Unit-cell length b length_b	42.310 Å
Unit-cell length c length_c	182.080 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.13 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	34.100 Å
R factor r_factor	0.2410
R_work r_work	0.2410
R_free r_free	0.3000

Crystal structure of intimin-Tir68 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

State in the Current Structure

Other States of the Same Protein in the Database

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zqk__assembly_4__model_1

2zqk__assembly_4__model_1 | I(q)

2zqk__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of intimin-Tir68 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zqk__assembly_4__model_1

2zqk__assembly_4__model_1 | I(q)

2zqk__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (1)