2zwk

Crystal structure of intimin-Tir90 complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Putative translocated intimin receptor protein (Translocated intimin receptor Tir) × 4 （Q7DB77）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Putative translocated intimin receptor protein (Translocated intimin receptor Tir) × 4 （Q7DB77）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EAE_ECO57
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–184； UniProt 752–934 Author chain C； PDBConstruct 2–184； UniProt 752–934 Author chain E； PDBConstruct 2–184； UniProt 752–934

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

Escherichia coli

UniProt Q7DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Intimin × 4 （P43261）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Intimin × 4 （P43261）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7DB77_ECO57
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–64； UniProt 274–336 Author chain D； PDBConstruct 2–64； UniProt 274–336 Author chain F； PDBConstruct 2–64； UniProt 274–336

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zwk
Deposition date deposition_date	2008-12-16
Structure title title	Crystal structure of intimin-Tir90 complex
Keywords keywords	;protein-protein complex, unique intimin-Tir octamer intermediate, Cell membrane, Cell outer membrane, Membrane, Transmembrane, Virulence, Receptor, Cell Adhesion ;; CELL ADHESION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2zwk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2zwk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2zwk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.27 Å
Rg (electron density)	53.13 Å
Total Rg	52.51 Å
Atom count	7540
Residues	984
Excluded volume	133170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zwk__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2zwk__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Intimin
Molecular weight formula_weight	20171.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	5655

MFFDELKIDNKVDIIGNNVRGELPNIWLQYGQFKLKASGGDGTYSWYSENTSIATVDASGKVTLNGKGSVVIKATSGDKQTVSYTIKAPSYMIKVDKQAYYADAMSICKNLLPSTQTVLSDIYDSWGAANKYSHYSSMNSITAWIKQTSSEQRSGVSSTYNLITQNPLPGVNVNTPNVYAVCVE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	155864
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Putative translocated intimin receptor protein (Translocated intimin receptor Tir)
Molecular weight formula_weight	7988.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

MATETATRDQLTKEAFQNPDNQKVNIDELGNAIPSGVLKDDVVANIEEQAKAAGEEAKQQAIENLEHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	155864
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d2zwka1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.14 — Invasin/intimin cell-adhesion fragments
Family Family family	b.1.14.0 — automated matches

Domain ID domain_id	d2zwka2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.0 — automated matches

Domain ID domain_id	d2zwkc1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.14 — Invasin/intimin cell-adhesion fragments
Family Family family	b.1.14.0 — automated matches

Domain ID domain_id	d2zwkc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.0 — automated matches

Domain ID domain_id	d2zwke1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.14 — Invasin/intimin cell-adhesion fragments
Family Family family	b.1.14.0 — automated matches

Domain ID domain_id	d2zwke2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.0 — automated matches

CATH v4.4 (9 domains)

Domain ID domain_id	2zwkA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1080 —

Domain ID domain_id	2zwkA02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	2zwkB00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

Domain ID domain_id	2zwkC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1080 —

Domain ID domain_id	2zwkC02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	2zwkD00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

Domain ID domain_id	2zwkE01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1080 —

Domain ID domain_id	2zwkE02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	2zwkF00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	820 — Translocated Intimin Receptor; Chain T
Homologous superfamily homologous superfamily	10 — Translocated intimin receptor, central domain

▶

Unit-cell length a length_a	96.780 Å
Unit-cell length b length_b	96.780 Å
Unit-cell length c length_c	644.310 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 41 2 2
Space-group number int_tables_number	98
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	66.670 Å
R factor r_factor	—
R_work r_work	0.3010
R_free r_free	0.3600

Crystal structure of intimin-Tir90 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

State in the Current Structure

Other States of the Same Protein in the Database

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zwk__assembly_1__model_1

2zwk__assembly_1__model_1 | I(q)

2zwk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (6 domains)

CATH v4.4 (9 domains)

7. Citations (1)

Crystal structure of intimin-Tir90 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Intimin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative translocated intimin receptor protein (Translocated intimin receptor Tir)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zwk__assembly_1__model_1

2zwk__assembly_1__model_1 | I(q)

2zwk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (6 domains)

CATH v4.4 (9 domains)

7. Citations (1)