2zs1

Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular giant hemoglobin major globin subunit A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） Extracellular giant hemoglobin major globin subunit B1 × 6 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 GLYCEROL × 36 CHLORIDE ION × 6 MAGNESIUM ION × 6 water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	Extracellular giant hemoglobin major globin subunit A2 × 3 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 3 （Q7M418） Extracellular giant hemoglobin major globin subunit B1 × 3 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 12 OXYGEN MOLECULE × 12 GLYCEROL × 18 CHLORIDE ION × 3 MAGNESIUM ION × 3 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBA1_OLIMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–140； UniProt 17–156

Extracellular giant hemoglobin major globin subunit A2

OrganismNot specified

UniProt Q7M413

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） Extracellular giant hemoglobin major globin subunit B1 × 6 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 GLYCEROL × 36 CHLORIDE ION × 6 MAGNESIUM ION × 6 water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	Extracellular giant hemoglobin major globin subunit A1 × 3 （Q7M419） Extracellular giant hemoglobin major globin subunit B2 × 3 （Q7M418） Extracellular giant hemoglobin major globin subunit B1 × 3 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 12 OXYGEN MOLECULE × 12 GLYCEROL × 18 CHLORIDE ION × 3 MAGNESIUM ION × 3 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBA2_OLIMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–142； UniProt 17–158

Extracellular giant hemoglobin major globin subunit B2

OrganismNot specified

UniProt Q7M418

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Extracellular giant hemoglobin major globin subunit B1 × 6 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 GLYCEROL × 36 CHLORIDE ION × 6 MAGNESIUM ION × 6 water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	Extracellular giant hemoglobin major globin subunit A1 × 3 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 3 （Q7M413） Extracellular giant hemoglobin major globin subunit B1 × 3 （Q5KSB7） PROTOPORPHYRIN IX CONTAINING FE × 12 OXYGEN MOLECULE × 12 GLYCEROL × 18 CHLORIDE ION × 3 MAGNESIUM ION × 3 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBB2_OLIMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–147； UniProt 17–163

Extracellular giant hemoglobin major globin subunit B1

OrganismNot specified

UniProt Q5KSB7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	Extracellular giant hemoglobin major globin subunit A1 × 6 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 6 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 6 （Q7M418） PROTOPORPHYRIN IX CONTAINING FE × 24 OXYGEN MOLECULE × 24 GLYCEROL × 36 CHLORIDE ION × 6 MAGNESIUM ION × 6 water × 24	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	Extracellular giant hemoglobin major globin subunit A1 × 3 （Q7M419） Extracellular giant hemoglobin major globin subunit A2 × 3 （Q7M413） Extracellular giant hemoglobin major globin subunit B2 × 3 （Q7M418） PROTOPORPHYRIN IX CONTAINING FE × 12 OXYGEN MOLECULE × 12 GLYCEROL × 18 CHLORIDE ION × 3 MAGNESIUM ION × 3 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLBB1_OLIMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–145； UniProt 17–161

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2zs1
Deposition date deposition_date	2008-09-02
Structure title title	Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
Keywords keywords	hemoglobin, annelida, magnesium, cooperativity, Heme, Iron, Metal-binding, Oxygen transport, Secreted, Transport, Oxygen Storage; Oxygen Storage, Oxygen transport
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2zs1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2zs1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2zs1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	47.36 Å
Rg (electron density)	46.51 Å
Total Rg	46.78 Å
Atom count	26886
Residues	3444
Excluded volume	470720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2zs1__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2zs1__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Extracellular giant hemoglobin major globin subunit A1
Molecular weight formula_weight	15188.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5363

VCNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCFNQHAWGECYERIASGISG

Entity 2 Entity 2 polymer

Description description	Extracellular giant hemoglobin major globin subunit A2
Molecular weight formula_weight	15327.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG

Entity 3 Entity 3 polymer

Description description	Extracellular giant hemoglobin major globin subunit B2
Molecular weight formula_weight	15621.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

SSCCSSEDRANVMHNWDAAWSAAYSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARAGVAAAHFDVMAEAFAEVMPQVSSCFSSDSWNRCFARIANGISAGL

Entity 4 Entity 4 polymer

Description description	Extracellular giant hemoglobin major globin subunit B1
Molecular weight formula_weight	14693.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGDSSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL

Entity 5 Entity 5 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	OXYGEN MOLECULE
Molecular weight formula_weight	32.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 7 Entity 7 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 8 Entity 8 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	643

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2zs1a_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.0 — automated matches

Domain ID domain_id	d2zs1b_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.0 — automated matches

Domain ID domain_id	d2zs1c_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.0 — automated matches

Domain ID domain_id	d2zs1d_
Class class	a — All alpha proteins
Fold Fold fold	a.1 — Globin-like
Superfamily Superfamily superfamily	a.1.1 — Globin-like
Family Family family	a.1.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	2zs1A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2zs1B00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2zs1C00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

Domain ID domain_id	2zs1D00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	490 — Globin-like
Homologous superfamily homologous superfamily	10 — Globins

▶

Unit-cell length a length_a	111.302 Å
Unit-cell length b length_b	111.302 Å
Unit-cell length c length_c	274.930 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	47.760 Å
R factor r_factor	0.1800
R_work r_work	0.1800
R_free r_free	0.2070

Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Extracellular giant hemoglobin major globin subunit A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular giant hemoglobin major globin subunit A2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular giant hemoglobin major globin subunit B2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Extracellular giant hemoglobin major globin subunit B1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2zs1__assembly_1__model_1

2zs1__assembly_1__model_1 | I(q)

2zs1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)