SAXSdb — 2ztt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-directed RNA polymerase catalytic subunit

Influenza A virus (A/Puerto Rico/8/34(H1N1))

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Polymerase basic protein 2 × 1 （P03428） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Polymerase basic protein 2 × 1 （P03428） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RDRP_I34A1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–79； UniProt 679–757 Author chain C； PDBConstruct 1–79； UniProt 679–757

Polymerase basic protein 2

Influenza A virus (A/Puerto Rico/8/34(H1N1))

UniProt P03428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	RNA-directed RNA polymerase catalytic subunit × 1 （P03431） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	RNA-directed RNA polymerase catalytic subunit × 1 （P03431） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PB2_I34A1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–40； UniProt 1–37 Author chain D； PDBConstruct 4–40； UniProt 1–37

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2ztt
Deposition date deposition_date	2008-10-08
Structure title title	Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus
Keywords keywords	;Influenza virus, RNA polymerase, PB1-PB2 complex form, Nucleotide-binding, Nucleotidyltransferase, Nucleus, RNA replication, RNA-directed RNA polymerase, Transferase, Mitochondrion, mRNA capping, mRNA processing, Virion ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2ztt__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2ztt__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2ztt__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.97 Å
Rg (electron density)	14.10 Å
Total Rg	14.99 Å
Atom count	888
Residues	101
Excluded volume	15963 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2ztt__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2ztt__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	RNA-directed RNA polymerase catalytic subunit
Molecular weight formula_weight	9588.4 kDa
EC 编号 ec_number	2.7.7.48
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	1830

QRGVLEDEQMYQRCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEFTEIMKICSTIEELRRQK

Source Source

Source organism organism	Influenza A virus (A/Puerto Rico/8/34(H1N1))
NCBI taxonomy ID ncbi_taxonomy_id	211044
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Polymerase basic protein 2
Molecular weight formula_weight	4731.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GGSMERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSG

Source Source

Source organism organism	Influenza A virus (A/Puerto Rico/8/34(H1N1))
NCBI taxonomy ID ncbi_taxonomy_id	211044
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	33

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d2ztta_
Class class	j — Peptides
Fold Fold fold	j.151 — PB1 fragments
Superfamily Superfamily superfamily	j.151.1 — PB1 fragments
Family Family family	j.151.1.1 — PB1 fragments

CATH v4.4 (2 domains)

Domain ID domain_id	2zttA00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	720 —

Domain ID domain_id	2zttC00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	720 —

▶

Unit-cell length a length_a	44.273 Å
Unit-cell length b length_b	61.477 Å
Unit-cell length c length_c	45.473 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.35 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2345
R_work r_work	0.2324
R_free r_free	0.2716

Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-directed RNA polymerase catalytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

Polymerase basic protein 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ztt__assembly_2__model_1

2ztt__assembly_2__model_1 | I(q)

2ztt__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of RNA polymerase PB1-PB2 subunits from Influenza A Virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

RNA-directed RNA polymerase catalytic subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polymerase basic protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2ztt__assembly_2__model_1

2ztt__assembly_2__model_1 | I(q)

2ztt__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (1 domains)

CATH v4.4 (2 domains)

7. Citations (1)