SAXSdb — 3aha

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transmembrane protein gp41

Human immunodeficiency virus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transmembrane protein gp41 × 3 （Q70626） (4S)-2-METHYL-2,4-PENTANEDIOL × 1 CHLORIDE ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q72502_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–36； UniProt 544–578 Author chain C； PDBConstruct 2–36； UniProt 544–578 Author chain E； PDBConstruct 2–36； UniProt 544–578

Transmembrane protein gp41

Human immunodeficiency virus 1

UniProt Q70626

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Transmembrane protein gp41 × 3 （Q72502） (4S)-2-METHYL-2,4-PENTANEDIOL × 1 CHLORIDE ION × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENV_HV1LW
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–34； UniProt 628–660 Author chain D； PDBConstruct 2–34； UniProt 628–660 Author chain F； PDBConstruct 2–34； UniProt 628–660

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3aha
Deposition date deposition_date	2010-04-22
Structure title title	Crystal structure of the complex between gp41 fragments N36 and C34 mutant N126K/E137Q
Keywords keywords	coiled-coil, VIRAL PROTEIN-INHIBITOR COMPLEX, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3aha__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3aha__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3aha__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.58 Å
Rg (electron density)	18.65 Å
Total Rg	19.69 Å
Atom count	1813
Residues	210
Excluded volume	32160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3aha__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Transmembrane protein gp41
Molecular weight formula_weight	4208.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	1959

XSDIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILX

Source Source

Source organism organism	Human immunodeficiency virus 1
Common name common_name	HIV-1
NCBI taxonomy ID ncbi_taxonomy_id	11676
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Transmembrane protein gp41
Molecular weight formula_weight	4289.7 kDa
Mutation mutation	N126K, E137Q
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

XWMEWDREINKYTSLIHSLIEQSQNQQEKNEQELLX

Source Source

Source organism organism	Human immunodeficiency virus 1
Common name common_name	HIV-1
NCBI taxonomy ID ncbi_taxonomy_id	11676
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	(4S)-2-METHYL-2,4-PENTANEDIOL
Molecular weight formula_weight	118.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	146

▶

Unit-cell length a length_a	88.632 Å
Unit-cell length b length_b	50.479 Å
Unit-cell length c length_c	56.154 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.88 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	23.880 Å
R factor r_factor	0.1902
R_work r_work	0.1886
R_free r_free	0.2193

Crystal structure of the complex between gp41 fragments N36 and C34 mutant N126K/E137Q

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transmembrane protein gp41

State in the Current Structure

Other States of the Same Protein in the Database

Transmembrane protein gp41

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aha__assembly_1__model_1

3aha__assembly_1__model_1 | I(q)

3aha__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of the complex between gp41 fragments N36 and C34 mutant N126K/E137Q

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transmembrane protein gp41

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transmembrane protein gp41

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aha__assembly_1__model_1

3aha__assembly_1__model_1 | I(q)

3aha__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)