SAXSdb — 3aiz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase sliding clamp B

Sulfolobus tokodaii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DNA polymerase sliding clamp C × 2 （Q973F5） SULFATE ION × 8 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	DNA polymerase sliding clamp C × 2 （Q973F5） SULFATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCNA2_SULTO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–248； UniProt 1–248 Author chain B； PDBConstruct 1–248； UniProt 1–248

DNA polymerase sliding clamp C

Sulfolobus tokodaii

UniProt Q973F5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	DNA polymerase sliding clamp B × 2 （Q975M2） SULFATE ION × 8 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	DNA polymerase sliding clamp B × 2 （Q975M2） SULFATE ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCNA3_SULTO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246 Author chain D； PDBConstruct 1–246； UniProt 1–246

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3aiz
Deposition date deposition_date	2010-05-18
Structure title title	Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)
Keywords keywords	PROTEIN-PROTEIN COMPLEX, REPLICATION; REPLICATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3aiz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3aiz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3aiz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.65 Å
Rg (electron density)	39.96 Å
Total Rg	40.41 Å
Atom count	7788
Residues	988
Excluded volume	139780 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3aiz__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3aiz__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	DNA polymerase sliding clamp B
Molecular weight formula_weight	27574.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7809

MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYLTDDKVLMVIFKIPKEYLEDYTIDKPLGIKININDLKKILGKAKSKSATVTLEETEAGLKVTVRDEKTGTRSNIYIKGEKTSIDQLTEPKVNLSVTFTTDGDVLKDIARDLSLVGEEVEISADENTVTLSTEEAGRTYKSLLKQDKPLKSLNVESPSKAVYSIEVLKDVFKVTSISQNVTVGFGNNIPMKIEVPTDSGGQLIFWIAPRL

Source Source

Source organism organism	Sulfolobus tokodaii
NCBI taxonomy ID ncbi_taxonomy_id	273063
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	DNA polymerase sliding clamp C
Molecular weight formula_weight	27459.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MRVKVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDILIPAGYFEEYNVEKEEKVGVKLEDFTDVLKTVTKNDSLYLETDENQNIKVTLDGVYERTFTFPSIVASEIETPNLNLEFPFKAKALTVTFTDIIDEIEDIGGDSITFKAEGGKLYLSANSDMGSSTIELSTENGGLLESEGGDAESVYGLEYVVNTSKMRKPSDTVEIAFGSQIPLKLRYNLPQGGYADFYIAPRAE

Source Source

Source organism organism	Sulfolobus tokodaii
NCBI taxonomy ID ncbi_taxonomy_id	273063
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	41

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3aizc1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.131 — DNA clamp
Superfamily Superfamily superfamily	d.131.1 — DNA clamp
Family Family family	d.131.1.0 — automated matches

Domain ID domain_id	d3aizc2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.131 — DNA clamp
Superfamily Superfamily superfamily	d.131.1 — DNA clamp
Family Family family	d.131.1.0 — automated matches

Domain ID domain_id	d3aizd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.131 — DNA clamp
Superfamily Superfamily superfamily	d.131.1 — DNA clamp
Family Family family	d.131.1.0 — automated matches

Domain ID domain_id	d3aizd2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.131 — DNA clamp
Superfamily Superfamily superfamily	d.131.1 — DNA clamp
Family Family family	d.131.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	3aizA01
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3aizB01
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3aizC00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3aizD00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	91.110 Å
Unit-cell length b length_b	160.570 Å
Unit-cell length c length_c	116.560 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	48.640 Å
R factor r_factor	0.2248
R_work r_work	0.2231
R_free r_free	0.2563

Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase sliding clamp B

State in the Current Structure

Other States of the Same Protein in the Database

DNA polymerase sliding clamp C

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aiz__assembly_1__model_1

3aiz__assembly_1__model_1 | I(q)

3aiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA polymerase sliding clamp B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA polymerase sliding clamp C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3aiz__assembly_1__model_1

3aiz__assembly_1__model_1 | I(q)

3aiz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)