SAXSdb — 3cn6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

Spinacia oleracea

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	CADMIUM ION × 4 water × 4	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 4	CADMIUM ION × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41372_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 24–304； UniProt 1–281 Author chain B； PDBConstruct 24–304； UniProt 1–281

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3cn6
Deposition date deposition_date	2008-03-25
Structure title title	Crystal structure of the Spinach Aquaporin SoPIP2;1 S274E mutant
Keywords keywords	membrane protein, aquaporin, Transmembrane, Transport, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3cn6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3cn6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3cn6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.14 Å
Rg (electron density)	27.13 Å
Total Rg	28.11 Å
Atom count	7316
Residues	972
Excluded volume	133470 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3cn6__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3cn6__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Aquaporin
Molecular weight formula_weight	32600.8 kDa
Mutation mutation	S274E
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3703

MSHHHHHHSSGLVPRGSHMLEDLMSKEVSEEAQAHQHGKDYVDPPPAPFFDLGELKLWSFWRAAIAEFIATLLFLYITVATVIGHSKETVVCGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKALGEFRSNPTN

Source Source

Source organism organism	Spinacia oleracea
Common name common_name	Spinach
NCBI taxonomy ID ncbi_taxonomy_id	3562
Host organism host_organism	Pichia pastoris

Entity 2 Entity 2 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	45

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3cn6a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

Domain ID domain_id	d3cn6b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	3cn6A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

Domain ID domain_id	3cn6B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

▶

Unit-cell length a length_a	89.558 Å
Unit-cell length b length_b	89.558 Å
Unit-cell length c length_c	189.271 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 4
Space-group number int_tables_number	79
Crystal system crystal_system	—

Resolution resolution	2.950 Å
Low-resolution limit resolution_low	34.860 Å
R factor r_factor	0.1974
R_work r_work	0.1957
R_free r_free	0.2298

Crystal structure of the Spinach Aquaporin SoPIP2;1 S274E mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cn6__assembly_1__model_1

3cn6__assembly_1__model_1 | I(q)

3cn6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of the Spinach Aquaporin SoPIP2;1 S274E mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3cn6__assembly_1__model_1

3cn6__assembly_1__model_1 | I(q)

3cn6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)