SAXSdb — 4ia4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

Spinacia oleracea

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	MERCURY (II) ION × 12 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q41372_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–281； UniProt 1–281 Author chain B； PDBConstruct 1–281； UniProt 1–281 Author chain C； PDBConstruct 1–281； UniProt 1–281 Author chain D； PDBConstruct 1–281； UniProt 1–281

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ia4
Deposition date deposition_date	2012-12-06
Structure title title	Structure of the spinach aquaporin SoPIP2;1 at pH 6
Keywords keywords	integral membrane protein, aquaporin, water channel protein, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4ia4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4ia4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4ia4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.11 Å
Rg (electron density)	27.18 Å
Total Rg	28.02 Å
Atom count	7289
Residues	967
Excluded volume	133240 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4ia4__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Aquaporin
Molecular weight formula_weight	29929.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	7290

MSKEVSEEAQAHQHGKDYVDPPPAPFFDLGELKLWSFWRAAIAEFIATLLFLYITVATVIGHSKETVVCGSVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLLRALVYMIAQCLGAICGVGLVKAFMKGPYNQFGGGANSVALGYNKGTALGAEIIGTFVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKALGSFRSNPTN

Source Source

Source organism organism	Spinacia oleracea
Common name common_name	Spinach
NCBI taxonomy ID ncbi_taxonomy_id	3562
Host organism host_organism	Komagataella pastoris

Entity 2 Entity 2 non-polymer

Description description	MERCURY (II) ION
Molecular weight formula_weight	200.6 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4ia4a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

Domain ID domain_id	d4ia4b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

Domain ID domain_id	d4ia4c_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

Domain ID domain_id	d4ia4d_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.19 — Aquaporin-like
Superfamily Superfamily superfamily	f.19.1 — Aquaporin-like
Family Family family	f.19.1.0 — automated matches

CATH v4.4 (4 domains)

Domain ID domain_id	4ia4A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

Domain ID domain_id	4ia4B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

Domain ID domain_id	4ia4C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

Domain ID domain_id	4ia4D00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1080 — Glycerol uptake facilitator protein
Homologous superfamily homologous superfamily	10 — Glycerol uptake facilitator protein.

▶

Unit-cell length a length_a	178.227 Å
Unit-cell length b length_b	104.190 Å
Unit-cell length c length_c	66.523 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	90.110 Å
R factor r_factor	0.2373
R_work r_work	0.2370
R_free r_free	0.2428

Structure of the spinach aquaporin SoPIP2;1 at pH 6

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ia4__assembly_1__model_1

4ia4__assembly_1__model_1 | I(q)

4ia4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of the spinach aquaporin SoPIP2;1 at pH 6

1. Protein Identity and Related Structures Protein Identity & Related Structures

Aquaporin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ia4__assembly_1__model_1

4ia4__assembly_1__model_1 | I(q)

4ia4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)