SAXSdb — 3eno

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative O-sialoglycoprotein endopeptidase

Thermoplasma acidophilum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	uncharacterized protein PF2011 × 2 （Q8TZI1） MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	uncharacterized protein PF2011 × 2 （Q8TZI1） MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GCP_THEAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–334； UniProt 1–329 Author chain B； PDBConstruct 6–334； UniProt 1–329

uncharacterized protein PF2011

Pyrococcus furiosus

UniProt Q8TZI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Putative O-sialoglycoprotein endopeptidase × 1 （Q9HLA5） MAGNESIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Putative O-sialoglycoprotein endopeptidase × 1 （Q9HLA5） MAGNESIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8TZI1_PYRFU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 6–87； UniProt 1–82 Author chain D； PDBConstruct 6–87； UniProt 1–82 Author chain E； PDBConstruct 6–87； UniProt 1–82 Author chain F； PDBConstruct 6–87； UniProt 1–82

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3eno
Deposition date deposition_date	2008-09-25
Structure title title	Crystal structure of Pyrococcus furiosus Pcc1 in complex with Thermoplasma acidophilum Kae1
Keywords keywords	;Hydrolase, Metal-binding, Metalloprotease, Protease, Zinc, KEOPS complex, ATPase, metal ion binding, dimerization module, telomere, hydrolase-unknown function COMPLEX ;; hydrolase/unknown function
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3eno__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3eno__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3eno__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.19 Å
Rg (electron density)	25.63 Å
Total Rg	26.37 Å
Atom count	3728
Residues	482
Excluded volume	67186 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3eno__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3eno__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Putative O-sialoglycoprotein endopeptidase
Molecular weight formula_weight	36056.8 kDa
EC 编号 ec_number	3.4.24.57
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	7471

GAMDPMIVLGLEGTAHTISCGIIDESRILAMESSMYRPKTGGIRPLDAAVHHSEVIDTVISRALEKAKISIHDIDLIGFSMGPGLAPSLRVTATAARTISVLTGKPIIGVNHPLGHIEIGRRVTGAIDPVMLYVSGGNTQVIAHVNGRYRVLGETLDIGIGNMIDKFAREAGIPFPGGPEIEKLAMKGTKLLDLPYSVKGMDTAFSGILTAALQYLKTGQAIEDISYSIQETAFAMLVEVLERALYVSGKDEILMAGGVALNRRLRDMVTNMAREAGIRSYLTDREYCMDNGIMIAQAALLMYKSGVRMSVEETAVNPRFRIDEVDAPWITDAS

Source Source

Source organism organism	Thermoplasma acidophilum
NCBI taxonomy ID ncbi_taxonomy_id	2303
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	uncharacterized protein PF2011
Molecular weight formula_weight	9900.5 kDa
Mutation mutation	I12M
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F

GAMDPMKAKRVQAKIEMEFPSEDVAKVVYEAVLYEHLSVPYRRSEIDFKLEGKKIILDIKATDSSALRGTVNSYLRWIKAAIDVIEV

Source Source

Source organism organism	Pyrococcus furiosus
NCBI taxonomy ID ncbi_taxonomy_id	2261
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3enoA01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	3enoA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	3enoB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	3enoB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	40 — ATPase, nucleotide binding domain

Domain ID domain_id	3enoC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	50 — Alpha-D-phosphohexomutase, C-terminal domain

Domain ID domain_id	3enoD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	50 — Alpha-D-phosphohexomutase, C-terminal domain

Domain ID domain_id	3enoE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	50 — Alpha-D-phosphohexomutase, C-terminal domain

Domain ID domain_id	3enoF00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	50 — Alpha-D-phosphohexomutase, C-terminal domain

▶

Unit-cell length a length_a	66.560 Å
Unit-cell length b length_b	66.560 Å
Unit-cell length c length_c	435.559 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	—

Resolution resolution	3.020 Å
Low-resolution limit resolution_low	39.581 Å
R factor r_factor	0.2450
R_work r_work	0.2430
R_free r_free	0.2818

Crystal structure of Pyrococcus furiosus Pcc1 in complex with Thermoplasma acidophilum Kae1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative O-sialoglycoprotein endopeptidase

State in the Current Structure

Other States of the Same Protein in the Database

uncharacterized protein PF2011

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eno__assembly_1__model_1

3eno__assembly_1__model_1 | I(q)

3eno__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of Pyrococcus furiosus Pcc1 in complex with Thermoplasma acidophilum Kae1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative O-sialoglycoprotein endopeptidase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uncharacterized protein PF2011

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eno__assembly_1__model_1

3eno__assembly_1__model_1 | I(q)

3eno__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)