SAXSdb — 3eoj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	BACTERIOCHLOROPHYLL A × 24 1,2-ETHANEDIOL × 45 SODIUM ION × 3 AMMONIUM ION × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCPA_PROAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–366； UniProt 1–366

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3eoj
Deposition date deposition_date	2008-09-27
Structure title title	Fmo protein from Prosthecochloris Aestuarii 2K AT 1.3A Resolution
Keywords keywords	;EXCITATION ENERGY TRANSFER, BETA SHEET, GAMMA-TURNS, Bacteriochlorophyll, Chlorophyll, Chromophore, Electron transport, Magnesium, Metal-binding, Photosynthesis, Reaction center, Transport ;; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3eoj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3eoj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3eoj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.40 Å
Rg (electron density)	29.73 Å
Total Rg	30.69 Å
Atom count	9715
Residues	1077
Excluded volume	176130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3eoj__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Bacteriochlorophyll a protein
Molecular weight formula_weight	40282.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4115

ALFGTKDTTTAHSDYEIILEGGSSSWGQVKGRAKVNVPAAIPLLPTDCNIRIDAKPLDAQKGVVRFTTKIESVVDSVKNTLNVEVDIANETKDRRIAVGEGSLSVGDFSHSFSFEGSVVNMYYYRSDAVRRNIPNPIYMQGRQFHDILMKVPLDNNDLVDTWEGFQQSISGGGANFGDWIREFWFIGPAFAAINEGGQRISPIVVNSSNVEGGEKGPVGVTRWKFSHAGSGVVDSISRWTELFPVEQLNKPASIEGGFRSDSQGIEVKVDGNLPGVSRDAGGGLRRILNHPLIPLVHHGMVGKFNDFTVDTQLKIVLPKGYKIRYAAPQFRSQNLEEYRWSGGAYARWVEHVCKGGTGQFEVLYAQ

Entity 2 Entity 2 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	AMMONIUM ION
Molecular weight formula_weight	18.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	406

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d3eoja_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

CATH v4.4 (1 domains)

Domain ID domain_id	3eojA00
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	10 — Bacteriochlorophyll-a Protein
Homologous superfamily homologous superfamily	10 — Bacteriochlorophyll A

▶

7. Citations (12)

The structural basis for the difference in absorbance spectra for the FMO antenna protein from various green sulfur bacteria.

Photosynth.Res. (2009)

PMID: 19437128 · DOI: 10.1007/s11120-009-9430-6 PRIMARY

;Refinement of the Structure of a Water-Soluble Antenna Complex from Green Photosynthetic Bacteria by Incorporation of the Chemically Determined Amino Acid Sequence ;

The Photosynthetic Reaction Center (1993)

;Structure and X-Ray Amino Acid Sequence of a Bacteriochlorophyll a Protein from Prosthecochloris Aestuarii Refined at 1.9 A Resolution ;

J.Mol.Biol. (1986)

PMID: 3735428 · DOI: 10.1016/0022-2836(86)90167-1

Structural Studies of a Bacteriochlorophyll-Containing Protein

Chem.Scr. (1983)

Lipid-Protein Interactions in a Bacteriochlorophyll-Containing Protein

Lipid-Protein Interactions (1982)

Structure of a Green Bacteriochlorophyll Protein

Acc.Chem.Res. (1980)

;Structure of a Bacteriochlorophyll A-Protein from the Green Photosynthetic Bacterium Prosthecochloris Aestuarii ;

J.Mol.Biol. (1979)

PMID: 490647 · DOI: 10.1016/0022-2836(79)90076-7

Bacteriochlorophyll A-Protein from Green Bacteria

The Photosynthetic Bacteria (1978)

;Atomic Coordinates for the Chlorophyll Core of a Bacteriochlorophyll A-Protein from Green Photosynthetic Bacteria ;

Biochem.Biophys.Res.Commun. (1977)

PMID: 856182

;An Evaluation of Electron Micrographs of Bacteriochlorophyll A-Protein Crystals in Terms of the Structure Determined by X-Ray Crystallography ;

J.Ultrastruct.Res. (1977)

PMID: 850296

Structure of a Bacteriochlorophyll A-Protein from Prosthecochloris Aestuarii

Brookhaven Symp.Biol. (1976)

Chlorophyll Arrangement in a Bacteriochlorophyll Protein from Chlorobium Limicola

Nature (1975)

DOI: 10.1038/258573a0

Unit-cell length a length_a	111.242 Å
Unit-cell length b length_b	111.242 Å
Unit-cell length c length_c	98.198 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 63
Space-group number int_tables_number	173
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1365
R_work r_work	0.1353
R_free r_free	0.1613

Fmo protein from Prosthecochloris Aestuarii 2K AT 1.3A Resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eoj__assembly_1__model_1

3eoj__assembly_1__model_1 | I(q)

3eoj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (12)

Fmo protein from Prosthecochloris Aestuarii 2K AT 1.3A Resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3eoj__assembly_1__model_1

3eoj__assembly_1__model_1 | I(q)

3eoj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (12)