SAXSdb — 3euj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein mukB, Linker

Haemophilus ducreyi (strain 35000HP / ATCC 700724)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Chromosome partition protein mukF × 2 （Q7VL94） PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MAGNESIUM ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MUKB_HAEDU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–242； UniProt 33–271 Author chain A； PDBConstruct 250–483； UniProt 1263–1496

Chromosome partition protein mukF

Haemophilus ducreyi

UniProt Q7VL94

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Chromosome partition protein mukB, Linker × 2 （Q7VL96） PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 MAGNESIUM ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MUKF_HAEDU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–152； UniProt 292–443

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3euj
Deposition date deposition_date	2008-10-10
Structure title title	Crystal structure of MukE-MukF(residues 292-443)-MukB(head domain)-ATPgammaS complex, symmetric dimer
Keywords keywords	;MukB, MukE, MukF, Chromosome condensation, condensin, SMC, non-SMC subunit, ABC-type ATPase, WHD, ATP-binding, Cell cycle, Cell division, Chromosome partition, DNA condensation, DNA-binding, Nucleotide-binding ;; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3euj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3euj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3euj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	32.77 Å
Rg (electron density)	31.83 Å
Total Rg	32.39 Å
Atom count	8388
Residues	1054
Excluded volume	149440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3euj__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Chromosome partition protein mukB, Linker
Molecular weight formula_weight	54102.8 kDa
Mutation mutation	E1435Q
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4224

GHMIARGKFRSLTLINWNGFFARTFDFDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLNFRNTTEAGSTSSSRDKGLYGKLKAGVCYAVLETVNSRAQRIITGVRLQQIAGRDKKVDIRPFSLQNVPMTDSVISLFTEQVANKARVLSLNDLKEKFEETAVTFKPYHSITDYHSFMFDLGILPKRLRSSSDRNKFYKLIEASLYGGISSVITKSLRDYLLPENSGVRQAFQDMEAALRENSGGSGGSISAESVANILRKTIQREQNRILQLNQGLQNIAFGQVKGVRLVVNIRDTHSILLNALSDQHEQHKDLFESQKLSFSEALAMLYKRINPHIELGQRMPQTIGEELLDYRNYLDLEVETLRGAYGWMRAESSALSTGEAIGTGMSILLMVVQSWEEESRRMRAKDILPCRLLFLDQAARLDAMSINTLFELCERLDMQLLIAAPENISPERGTTYKLVRKILANQEYVHVVGLKGFG

Source Source

Source organism organism	Haemophilus ducreyi (strain 35000HP / ATCC 700724)
NCBI taxonomy ID ncbi_taxonomy_id	233412
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Chromosome partition protein mukF
Molecular weight formula_weight	17334.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDKNRVFGQRLRQSIQNYFSSPWLLYTAKAEALLDLRDDEAMLNEMEAVGELPMALEYESLTDVQTQIVTAIQAELAHFRNTAQPINLGAVLQEQLARYPQSRHFDVARIIVDQAVKLGMASQDHQAVYPVWQPIDDFSAAVQAHLIDQYDK

Source Source

Source organism organism	Haemophilus ducreyi
NCBI taxonomy ID ncbi_taxonomy_id	730
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	30

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3eujA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1140 — N-terminal domain of mukB
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3eujB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	225 — NK-Lysin
Homologous superfamily homologous superfamily	40 — MukF, C-terminal domain

▶

Unit-cell length a length_a	58.522 Å
Unit-cell length b length_b	180.203 Å
Unit-cell length c length_c	138.496 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 2 2 21
Space-group number int_tables_number	17
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	—
R_work r_work	0.2590
R_free r_free	0.2910

Crystal structure of MukE-MukF(residues 292-443)-MukB(head domain)-ATPgammaS complex, symmetric dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein mukB, Linker

State in the Current Structure

Other States of the Same Protein in the Database

Chromosome partition protein mukF

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3euj__assembly_1__model_1

3euj__assembly_1__model_1 | I(q)

3euj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Crystal structure of MukE-MukF(residues 292-443)-MukB(head domain)-ATPgammaS complex, symmetric dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein mukB, Linker

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromosome partition protein mukF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3euj__assembly_1__model_1

3euj__assembly_1__model_1 | I(q)

3euj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)