SAXSdb — 3fse

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains

Anabaena variabilis ATCC 29413

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3M4J2_ANAVT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–365； UniProt 1–364 Author chain B； PDBConstruct 2–365； UniProt 1–364

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3fse
Deposition date deposition_date	2009-01-09
Structure title title	Crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 A resolution
Keywords keywords	Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3fse__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3fse__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3fse__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.30 Å
Rg (electron density)	27.75 Å
Total Rg	28.23 Å
Atom count	5187
Residues	668
Excluded volume	92625 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3fse__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains
Molecular weight formula_weight	40327.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5755

GMTNHNNSGKKKVAILIEQAVEDTEFIIPCNGLKQAGFEVVVLGSRMNEKYKGKRGRLSTQADGTTTEAIASEFDAVVIPGGMAPDKMRRNPNTVRFVQEAMEQGKLVAAVCHGPQVLIEGDLLRGKQATGFIAISKDMMNAGADYLDEALVVDGNLITSREPGDLAIFTTAILSRLGYGGKDAALPDEKDRNAEWWKLADAWGGSTKGDIVRGLNTALGGERYSLEALEKYTEKESDVEAKALFQEMITNKQRHIEYLETYLTRLGEKPSLSANIANQYAKVKTALTGSDDIYQIRSALGDIQTGIGDIGNLCAMYTDPIATAIFKEIYKDLVKYEQRLVSLYRTRTNATVQPPKPTTGAAVSM

Source Source

Source organism organism	Anabaena variabilis ATCC 29413
NCBI taxonomy ID ncbi_taxonomy_id	240292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	456

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3fseA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	880 — Class I glutamine amidotransferase (GATase) domain

Domain ID domain_id	3fseA02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

Domain ID domain_id	3fseB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	880 — Class I glutamine amidotransferase (GATase) domain

Domain ID domain_id	3fseB02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1260 — Ferritin
Homologous superfamily homologous superfamily	10 — Ferritin, core subunit, four-helix bundle

▶

Unit-cell length a length_a	137.360 Å
Unit-cell length b length_b	39.690 Å
Unit-cell length c length_c	123.060 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.04 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	29.975 Å
R factor r_factor	0.1780
R_work r_work	0.1760
R_free r_free	0.2190

Crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fse__assembly_1__model_1

3fse__assembly_1__model_1 | I(q)

3fse__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 A resolution

1. Protein Identity and Related Structures Protein Identity & Related Structures

two-domain protein containing DJ-1/ThiJ/PfpI-like and ferritin-like domains

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3fse__assembly_1__model_1

3fse__assembly_1__model_1 | I(q)

3fse__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)