SAXSdb — 3g74

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function

Eubacterium ventriosum ATCC 27560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	SULFATE ION × 4 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein monomer	Monomer	Protein 1	SULFATE ION × 1 water × 1	Consistent with protein count
5	Protein monomer	Monomer	Protein 1	SULFATE ION × 4 water × 1	Consistent with protein count
6	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
7	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count
8	Protein monomer	Monomer	Protein 1	SULFATE ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A5Z9E1_9FIRM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–100； UniProt 1–97 Author chain B； PDBConstruct 4–100； UniProt 1–97 Author chain C； PDBConstruct 4–100； UniProt 1–97 Author chain D； PDBConstruct 4–100； UniProt 1–97 Author chain E； PDBConstruct 4–100； UniProt 1–97 Author chain F； PDBConstruct 4–100； UniProt 1–97 Author chain G； PDBConstruct 4–100； UniProt 1–97 Author chain H； PDBConstruct 4–100； UniProt 1–97

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3g74
Deposition date deposition_date	2009-02-09
Structure title title	Crystal structure of a functionally unknown protein from Eubacterium ventriosum ATCC 27560
Keywords keywords	;APC21008.1, Eubacterium ventriosum ATCC 27560, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3g74__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3g74__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3g74__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.64 Å
Rg (electron density)	13.52 Å
Total Rg	14.64 Å
Atom count	712
Residues	82
Excluded volume	12867 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3g74__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3g74__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3g74__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`3g74__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`3g74__assembly_5__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`3g74__assembly_6__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`3g74__assembly_7__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`3g74__assembly_8__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Protein of unknown function
Molecular weight formula_weight	11656.6 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H
Atom count atom_count	5820

SNAMSDTLYIKMDQAVEITKKQVTVGDVAKLQCKNKNITNRLKSMKLLEDTTKGKKRYIVSIMKIIEMADQTFQNVDIQNIGETECVVEFKTPKKDDGPM

Source Source

Source organism organism	Eubacterium ventriosum ATCC 27560
NCBI taxonomy ID ncbi_taxonomy_id	411463
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	97

▼

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

Domain ID domain_id	3g74A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74D00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74E00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74F00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74G00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

Domain ID domain_id	3g74H00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	480 — eubacterium ventriosum atcc fold
Homologous superfamily homologous superfamily	10 — eubacterium ventriosum atcc domain

▶

Unit-cell length a length_a	113.996 Å
Unit-cell length b length_b	107.961 Å
Unit-cell length c length_c	67.691 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.28 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.430 Å
Low-resolution limit resolution_low	33.500 Å
R factor r_factor	0.2114
R_work r_work	0.2087
R_free r_free	0.2635

Crystal structure of a functionally unknown protein from Eubacterium ventriosum ATCC 27560

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3g74__assembly_1__model_1

3g74__assembly_1__model_1 | I(q)

3g74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)

Crystal structure of a functionally unknown protein from Eubacterium ventriosum ATCC 27560

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein of unknown function

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3g74__assembly_1__model_1

3g74__assembly_1__model_1 | I(q)

3g74__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 8 domains

CATH v4.4 (8 domains)

7. Citations (1)