3gw6

Intramolecular Chaperone

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endo-N-acetylneuraminidase

Enterobacteria phage K1F

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	DI(HYDROXYETHYL)ETHER × 7 TRIS(HYDROXYETHYL)AMINOMETHANE × 2 CHLORIDE ION × 1 BROMIDE ION × 4 CALCIUM ION × 1 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	DI(HYDROXYETHYL)ETHER × 11 TRIS(HYDROXYETHYL)AMINOMETHANE × 1 CHLORIDE ION × 5 BROMIDE ION × 2 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q858B1_BPK1F
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–275； UniProt 790–1064 Author chain B； PDBConstruct 1–275； UniProt 790–1064 Author chain C； PDBConstruct 1–275； UniProt 790–1064 Author chain D； PDBConstruct 1–275； UniProt 790–1064 Author chain E； PDBConstruct 1–275； UniProt 790–1064 Author chain F； PDBConstruct 1–275； UniProt 790–1064

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3gw6
Deposition date deposition_date	2009-03-31
Structure title title	Intramolecular Chaperone
Keywords keywords	Chaperone, Glycosidase, Hydrolase; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3gw6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3gw6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3gw6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.55 Å
Rg (electron density)	29.74 Å
Total Rg	30.30 Å
Atom count	6160
Residues	768
Excluded volume	108090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3gw6__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3gw6__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Endo-N-acetylneuraminidase
Molecular weight formula_weight	30707.9 kDa
EC 编号 ec_number	3.2.1.129
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,C,D,F
Atom count atom_count	12617

MEFTGDLGLGHVTIRASTSSNIRSEVLMEGEYGFIGKSIPTDNPAGQRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVTANGERKTEPVVFDDAFLDAWGDVHYIMYQWLDAVQLKGNDARIHFGVIAQQIRDVFIAHGLMDENSTNCRYAVLCYDKYPRMTDTVFSHNEIVEHTDEEGNVTTTEEPVYTEVVIHEEGEEWGVRPDGIFFAEAAYQRRKLERIEARLSALEQK

Source Source

Source organism organism	Enterobacteria phage K1F
Common name common_name	Bacteriophage K1F
NCBI taxonomy ID ncbi_taxonomy_id	344021
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 3 Entity 3 non-polymer

Description description	TRIS(HYDROXYETHYL)AMINOMETHANE
Molecular weight formula_weight	163.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	BROMIDE ION
Molecular weight formula_weight	79.9 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	323

▼

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

Domain ID domain_id	3gw6A01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6A02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1240 — Endo-n-acetylneuraminidase

Domain ID domain_id	3gw6A03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2460 — Endo-n-acetylneuraminidase fold
Homologous superfamily homologous superfamily	10 — Endo-n-acetylneuraminidase domain

Domain ID domain_id	3gw6A04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	3gw6B01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6B02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3gw6C01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6C02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3gw6D01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6D02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3gw6E01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6E02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	10 — Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain

Domain ID domain_id	3gw6F01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	1090 — Endosialidase, domain 4
Homologous superfamily homologous superfamily	10 — Endosialidase, domain 4

Domain ID domain_id	3gw6F02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1240 — Endo-n-acetylneuraminidase

Domain ID domain_id	3gw6F03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2460 — Endo-n-acetylneuraminidase fold
Homologous superfamily homologous superfamily	10 — Endo-n-acetylneuraminidase domain

Domain ID domain_id	3gw6F04
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

▶

Unit-cell length a length_a	62.650 Å
Unit-cell length b length_b	79.950 Å
Unit-cell length c length_c	109.580 Å
Unit-cell angle α angle_alpha	81.71 °
Unit-cell angle β angle_beta	76.53 °
Unit-cell angle γ angle_gamma	87.11 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	27.633 Å
R factor r_factor	0.2112
R_work r_work	0.2089
R_free r_free	0.2545

Intramolecular Chaperone

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endo-N-acetylneuraminidase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3gw6__assembly_1__model_1

3gw6__assembly_1__model_1 | I(q)

3gw6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)

Intramolecular Chaperone

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endo-N-acetylneuraminidase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3gw6__assembly_1__model_1

3gw6__assembly_1__model_1 | I(q)

3gw6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 16 domains

CATH v4.4 (16 domains)

7. Citations (1)