SAXSdb — 3gxq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative regulator of transfer genes ArtA

Staphylococcus aureus subsp. aureus USA300

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Homooligomer	Protein 2 DNA 2	;DNA (5'-D(APCPAPTPGPAPCPAPTPG)-3') ; × 1 ;DNA (5'-D(APCPAPTPGPTPCPAPTPGP*T)-3') ; × 1 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2FDC9_STAA3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–53； UniProt 6–58 Author chain B； PDBConstruct 1–53； UniProt 6–58

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3gxq
Deposition date deposition_date	2009-04-02
Structure title title	Structure of ArtA and DNA complex
Keywords keywords	ribbon-helix-helix, Plasmid, DNA BINDING PROTEIN-DNA COMPLEX; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3gxq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3gxq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3gxq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.81 Å
Rg (electron density)	16.00 Å
Total Rg	16.87 Å
Atom count	1288
Residues	128
Excluded volume	21812 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3gxq__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Putative regulator of transfer genes ArtA
Molecular weight formula_weight	6203.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1324

ENSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLEQIA

Source Source

Source organism organism	Staphylococcus aureus subsp. aureus USA300
NCBI taxonomy ID ncbi_taxonomy_id	367830
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(APCPAPTPGPAPCPAPTPG)-3') ;
Molecular weight formula_weight	3053.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

ACATGACATG

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(APCPAPTPGPTPCPAPTPGP*T)-3') ;
Molecular weight formula_weight	3348.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

ACATGTCATGT

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	36

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	3gxqA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1220 — Arc Repressor Mutant
Homologous superfamily homologous superfamily	10 — Met repressor-like

Domain ID domain_id	3gxqB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1220 — Arc Repressor Mutant
Homologous superfamily homologous superfamily	10 — Met repressor-like

▶

Unit-cell length a length_a	37.830 Å
Unit-cell length b length_b	61.130 Å
Unit-cell length c length_c	40.500 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.32 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.350 Å
Low-resolution limit resolution_low	35.980 Å
R factor r_factor	0.2370
R_work r_work	0.2370
R_free r_free	0.2610

Structure of ArtA and DNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative regulator of transfer genes ArtA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3gxq__assembly_1__model_1

3gxq__assembly_1__model_1 | I(q)

3gxq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Structure of ArtA and DNA complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Putative regulator of transfer genes ArtA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3gxq__assembly_1__model_1

3gxq__assembly_1__model_1 | I(q)

3gxq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)