3hph

Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD

Method: X-RAY DIFFRACTION D_max: 149.5 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrase

Maedi visna virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 823–1039 Chain B； UniProt 823–1039 Chain C； UniProt 823–1039 Chain D； UniProt 823–1039	Fragment：N-terminal and catalytic domains, UNP residues 923-1039	PC4 and SFRS1-interacting protein × 4 （O75475） ZN ZINC ION × 4 GOL GLYCEROL × 4 PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；0.7-0.9M (NH4)2HPO4, 2.5% Jeffamine M600,100mM Bis-Tris propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.64 Å R-free 0.253

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3HPH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain B 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain E 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain F 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain D 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain E 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain F 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain B 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain C 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039 Chain D 823–1039（217 aa） Fragment：N-terminal and catalytic core domains, UNP residues 823-1039	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
5LLJ Maedi-Visna virus (MVV) integrase C-terminal domain (residues 220-276) Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1039–1096（58 aa） Chain B 1039–1096（58 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；291 K；0.2M potassium sodium tartrate 0.1M BTP pH 7.5 20% PEG-3350	Resolution 1.78 Å R-free 0.234
5M0R Cryo-EM reconstruction of the maedi-visna virus (MVV) strand transfer complex Deposited 2016-10-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 16 PDB declaration: 22-meric	Chain A 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain B 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain C 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain D 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain E 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain F 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain G 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain H 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain I 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain J 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain K 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain L 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain M 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain N 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain O 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain P 821–1101（281 aa） Fragment：UNP residues 821-1101	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；To lower salt concentration before plunge-freezing, the grids were blotted for 0.5 s, immediately hydrated with a 4-ul drop of 200 mM NaCl, 3 mM CaCl2 and 25 mM BisTris-HCl pH 6.5 and blotted again for 2.5 s followed by plunging into liquid ethane.	Resolution 8.20 Å
5T3A Maedi-Visna virus (MVV) integrase CCD-CTD (residues 60-275) Deposited 2016-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 880–1101（222 aa）	Not recorded	ACT ACETATE ION × 6 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；0.1M Mes pH6.0, 15-100mM calcium acetate and 15-21% PEG 400	Resolution 2.50 Å R-free 0.240
7U32 MVV cleaved synaptic complex (CSC) intasome at 3.4 A resolution Deposited 2022-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 16 PDB declaration: eicosameric	Chain A 1226–1506（281 aa） Chain B 1226–1506（281 aa） Chain C 1226–1506（281 aa） Chain D 1226–1506（281 aa） Chain E 1226–1506（281 aa） Chain F 1226–1506（281 aa） Chain G 1226–1506（281 aa） Chain H 1226–1506（281 aa） Chain I 1226–1506（281 aa） Chain J 1226–1506（281 aa） Chain K 1226–1506（281 aa） Chain L 1226–1506（281 aa） Chain M 1226–1506（281 aa） Chain N 1226–1506（281 aa） Chain O 1226–1506（281 aa） Chain P 1226–1506（281 aa）	Not recorded	ZN ZINC ION × 12 CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；Cryo-EM grids were prepared by freezing using a manual plunger in cold room at 4C	Resolution 3.46 Å
7Z1Z MVV strand transfer complex (STC) intasome in complex with LEDGF/p75 at 3.5 A resolution Deposited 2022-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 24-meric	Chain A 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain B 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain C 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain D 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain E 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain F 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain G 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain H 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain I 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain J 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain K 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain L 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain M 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain N 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain O 821–1101（281 aa） Fragment：UNP residues 821-1101 Chain P 821–1101（281 aa） Fragment：UNP residues 821-1101	Not recorded	ZN ZINC ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5；310 mM NaCl, 3 mM CaCl2, 25 mM BisTris-HCl, pH 6.5. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7ZPP Cryo-EM structure of the MVV CSC intasome at 4.5A resolution Deposited 2022-04-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 16 PDB declaration: eicosameric	Chain A 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain B 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain C 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain D 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain E 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain F 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain G 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain H 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain I 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain J 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain K 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain L 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain M 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain N 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain O 1226–1506（281 aa） Fragment：UNP residues 821-1101 Chain P 1226–1506（281 aa） Fragment：UNP residues 821-1101	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5；1 M NaCl, 3 mM CaCl2 and 25 mM BisTris-HCl, pH 6.5 cryo-EM vitrification conditions Cryogen ETHANE；To lower salt concentration before plunge-freezing, the grids were blotted for 0.5 s, immediately hydrated with a 4-ul drop of 200 mM NaCl, 3 mM CaCl2 and 25 mM BisTris-HCl pH 6.5 and blotted again for 2.5 s followed by plunging into liquid ethane.	Resolution 4.50 Å

7 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POL_VILVK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–219； UniProt 823–1039 Author chain B； PDBConstruct 3–219； UniProt 823–1039 Author chain C； PDBConstruct 3–219； UniProt 823–1039 Author chain D； PDBConstruct 3–219； UniProt 823–1039

PC4 and SFRS1-interacting protein

Homo sapiens

UniProt O75475

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain E； UniProt 348–435 Chain F； UniProt 348–435 Chain G； UniProt 348–435 Chain H； UniProt 348–435	Fragment：Integrase binding domain, UNP residues 348-435	Integrase × 4 （P35956） ZN ZINC ION × 4 GOL GLYCEROL × 4 PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；0.7-0.9M (NH4)2HPO4, 2.5% Jeffamine M600,100mM Bis-Tris propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.64 Å R-free 0.253

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3HPH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1Z9E Solution structure of the HIV-1 integrase-binding domain in LEDGF/p75 Deposited 2005-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 347–471（125 aa） Fragment：sequence database residues 347-471 contains: HIV-1 integrase-binding domain (residues 347-429)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.25；298 K；Ionic strength (raw mmCIF value) 100 mM NaCl, 50 mM Posphate buffer；Pressure ambient NMR sample composition 0.7 mM protein, 100 mM NaCl, 50 mM Phosphate buffer, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.7 mM protein, 100 mM NaCl, 38 mM Na2HPO4, 12 mM NaH2PO4, 100% D2O \| 100% D2O	Resolution not provided
2B4J Structural basis for the recognition between HIV-1 integrase and LEDGF/p75 Deposited 2005-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 347–442（96 aa） Fragment：LEDGF Chain D 347–442（96 aa） Fragment：LEDGF	Not recorded	PO4 PHOSPHATE ION × 2 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；295 K；PEG-3350, Na2HPO4, NaH2PO4, KH2PO4, NACL, HEPES, pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.02 Å R-free 0.226
2B4J Structural basis for the recognition between HIV-1 integrase and LEDGF/p75 Deposited 2005-09-24	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 347–442（96 aa） Fragment：LEDGF Chain D 347–442（96 aa） Fragment：LEDGF	Not recorded	PO4 PHOSPHATE ION × 4 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；295 K；PEG-3350, Na2HPO4, NaH2PO4, KH2PO4, NACL, HEPES, pH 6.25, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.02 Å R-free 0.226
2M16 P75/LEDGF PWWP Domain Deposited 2012-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–93（93 aa） Fragment：unp residues 1-93	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；298 K；Ionic strength (raw mmCIF value) 0.35；Pressure ambient NMR sample composition 0.35-0.45 mM [U-99% 13C; U-99% 15N] entity, 50 mM HEPES, 150 mM sodium chloride, 2 mM beta-mercaptoethanol, 0.66 mM DSS, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2MSR Solution structure of LEDGF/p75 IBD in complex with MLL1 peptide (140-160) Deposited 2014-08-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 344–426（83 aa） Fragment：UNP residues 344-425	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 125；Pressure ambient NMR sample composition 0.5 mM MLL1_140, 0.5 mM [U-13C; U-15N] IBD, 25 mM HEPES, 100 mM sodium chloride, 0.05 % beta-mercaptoethanol, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
2MTN Solution structure of MLL-IBD complex Deposited 2014-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 337–442（106 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 0.05；Pressure ambient NMR sample composition 50 mM potassium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2N3A Solution structure of LEDGF/p75 IBD in complex with POGZ peptide (1389-1404) Deposited 2015-05-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 348–426（79 aa） Fragment：UNP residues 348-426	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 125；Pressure ambient NMR sample composition 0.5 mM peptide, 0.5 mM [U-13C; U-15N] protein, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain m 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain q 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain u 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 13 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain W 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain i 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 14 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain C 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain K 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain a 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 15 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain m 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain q 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain u 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 16 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain O 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain S 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435 Chain e 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 6 MG MAGNESIUM ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain S 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain W 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain a 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain e 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3F9K Two domain fragment of HIV-2 integrase in complex with LEDGF IBD Deposited 2008-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain i 347–435（89 aa） Fragment：LEDGF, Integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；291 K；2.6M sodium acetate, 10mM MgCl2, 0.1M Bis-Tris Propane-HCl, pH7.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.20 Å R-free 0.234
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain H 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain K 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain L 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain I 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain J 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain K 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain L 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
3HPG Visna virus integrase (residues 1-219) in complex with LEDGF IBD: examples of open integrase dimer-dimer interfaces Deposited 2009-06-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain H 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain I 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435 Chain J 347–435（89 aa） Fragment：integrase binding domain, UNP residues 347-435	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.6；291 K；25-30% Jeffamine M600, 100mM Bis-Tris propane-HCl, pH6.6, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.28 Å R-free 0.253
3U88 Crystal structure of human menin in complex with MLL1 and LEDGF Deposited 2011-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 347–435（89 aa）	Not recorded	CHD CHOLIC ACID × 1 GGB L-CANAVANINE × 4 0BR (4beta,8alpha,9R)-6'-methoxy-10,11-dihydrocinchonan-9-ol × 1 GLV GLYOXYLIC ACID × 4 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；277 K；1.6 M ammonium sulfate, pH 7.0, vapor diffusion, hanging drop, temperature 277K	Resolution 3.00 Å R-free 0.233
3U88 Crystal structure of human menin in complex with MLL1 and LEDGF Deposited 2011-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 347–435（89 aa）	Not recorded	CHD CHOLIC ACID × 1 GGB L-CANAVANINE × 1 0BR (4beta,8alpha,9R)-6'-methoxy-10,11-dihydrocinchonan-9-ol × 1 GLV GLYOXYLIC ACID × 2 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；277 K；1.6 M ammonium sulfate, pH 7.0, vapor diffusion, hanging drop, temperature 277K	Resolution 3.00 Å R-free 0.233
3ZEH Solution structure of the Hs. PSIP1 PWWP domain Deposited 2012-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–100（98 aa） Fragment：PWWP DOMAIN, RESIDUES 3-100	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 100；Pressure 1.0 NMR sample composition 90% WATER 10% D2O 20 MM NAPI PH 6 100 MM NACL	Resolution not provided
4FU6 Crystal structure of the PSIP1 PWWP domain Deposited 2012-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–135（135 aa） Fragment：UNP residues 1-135	Not recorded	SO4 SULFATE ION × 3 GOL GLYCEROL × 1 UNX UNKNOWN LIGAND × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；291 K；The protein sample was treated with V8 protease. 2.5M ammonium sulfate, 0.1M TRIS, pH 8.5, vapor diffusion, temperature 291K	Resolution 2.10 Å R-free 0.232
5N88 Crystal structure of antibody bound to viral protein Deposited 2017-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 347–424（78 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；277 K；25.0% PEG 3350, 10mM Tris pH8.5	Resolution 1.70 Å R-free 0.252
5N88 Crystal structure of antibody bound to viral protein Deposited 2017-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 347–425（79 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；277 K；25.0% PEG 3350, 10mM Tris pH8.5	Resolution 1.70 Å R-free 0.252
5OYM HIV Integrase Binding Domain of Lens Epithelium-Derived Growth Factor Deposited 2017-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 345–431（87 aa） Chain B 345–431（87 aa） Chain C 345–431（87 aa） Chain D 345–431（87 aa） Chain E 345–431（87 aa） Chain F 345–431（87 aa） Chain G 345–431（87 aa） Chain H 345–431（87 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；0.2 M Sodium Fluoride, 0.1 M bis-Tris propane, pH 8.5 and 20 % w/v PEG 3350	Resolution 2.05 Å R-free 0.236
5YI9 Solution structure of the LEDGF/p75 IBD - JPO2 (aa 56-91) complex Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–442（98 aa） Fragment：UNP RESIDUES 345-442,UNP RESIDUES 345-442	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 200；Pressure arbitrary NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF/p75 IBD- JPO2 M2, 50 mM TRIS, 150 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6EMO Solution structure of the LEDGF/p75 IBD - JPO2 (aa 1-32) complex Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–442（98 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 200；Pressure arbitrary NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF/p75 IBD-JPO2 M1, 50 mM TRIS, 150 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6EMP Solution structure of the LEDGF/p75 IBD - POGZ (aa 1370-1404) complex Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–442（98 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 200；Pressure arbitraty NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF/p75 IBD-POGZ, 50 mM TRIS, 150 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6EMQ Solution structure of the LEDGF/p75 IBD - MLL1 (aa 111-160) complex Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–443（99 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 200；Pressure arbitrary NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF/p75 IBD-MLL1, 50 mM TRIS, 150 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6EMR Solution structure of the LEDGF/p75 IBD - IWS1 (aa 446-548) complex Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–441（97 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 200；Pressure arbitrary NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF/p75 IBD-IWS1, 50 mM TRIS, 150 mM sodium chloride, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6S01 Structure of LEDGF PWWP domain bound H3K36 methylated nucleosome Deposited 2019-06-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；Solution were made from stock solution cryo-EM vitrification conditions Cryogen ETHANE；blot for 4 seconds before plunging	Resolution 3.20 Å
6TRJ LEDGF/p75 IBD dimer Deposited 2019-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 345–430（86 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1M DL-Glutamic acid monohydrate; 0.1M DL-Alanine; 0.1M Glycine; 0.1M DL-Lysine monohydrochloride; 0.1M DL-Serine; 0.1 M Tris (base); BICINE pH 8.5; 20% v/v Glycerol; 10% w/v PEG 4000 (Morpheus Molecular Dimensions condition H11)	Resolution 1.30 Å R-free 0.177
6TVM LEDGF/p75 dimer (residues 345-467) Deposited 2020-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 345–467（123 aa） Chain B 345–467（123 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120；Pressure 1 NMR sample composition 0.5 mM [U-13C; U-15N] LEDGF, 20 mM HEPES, 100 mM sodium chloride, 1 mM TCEP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
6ZV0 TFIIS N-terminal domain (TND) from human LEDGF/p75 Deposited 2020-07-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 345–431（87 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Ionic strength (raw mmCIF value) 225；Pressure 1 NMR sample composition 0.6 mM [U-13C; U-15N] LEDGF/p75, 25 mM [U-2H] TRIS, 200 mM sodium chloride, 1 mM TCEP, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
7OUF Structure of the STLV intasome:B56 complex bound to the strand-transfer inhibitor XZ450 Deposited 2021-06-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: decameric	Chain C 1–325（325 aa） Chain F 1–325（325 aa）	Not recorded	ZN ZINC ION × 4 MG MAGNESIUM ION × 4 1L0 4-azanyl-~{N}-[[2,4-bis(fluoranyl)phenyl]methyl]-6-[3-(dimethylamino)-3-oxidanylidene-propyl]-1-oxidanyl-2-oxidanylidene-1,8-naphthyridine-3-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
7OUG STLV-1 intasome:B56 in complex with the strand-transfer inhibitor raltegravir Deposited 2021-06-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: decameric	Chain C 1–325（325 aa） Chain F 1–325（325 aa）	Not recorded	ZN ZINC ION × 4 MG MAGNESIUM ION × 4 RLT N-(4-fluorobenzyl)-5-hydroxy-1-methyl-2-(1-methyl-1-{[(5-methyl-1,3,4-oxadiazol-2-yl)carbonyl]amino}ethyl)-6-oxo-1,6-di hydropyrimidine-4-carboxamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7PEL CryoEM structure of simian T-cell lymphotropic virus intasome in complex with PP2A regulatory subunit B56 gamma Deposited 2021-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: decameric	Chain C 1–325（325 aa） Chain F 1–325（325 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.34 Å
7Z1Z MVV strand transfer complex (STC) intasome in complex with LEDGF/p75 at 3.5 A resolution Deposited 2022-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 18 PDB declaration: 24-meric	Chain Q 347–435（89 aa） Chain R 347–435（89 aa）	Not recorded	ZN ZINC ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 6.5；310 mM NaCl, 3 mM CaCl2, 25 mM BisTris-HCl, pH 6.5. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8CBN structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome Deposited 2023-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain K 1–530（530 aa） Chain L 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.34 Å
8CBQ structure of LEDGF/p75 PWWP domain bound to the H3K36 trimethylated dinucleosome Deposited 2023-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8PC5 H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex Deposited 2023-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.02 Å
8PC6 H3K36me3 nucleosome-LEDGF/p75 PWWP domain complex - pose 2 Deposited 2023-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: dodecameric	Chain K 1–530（530 aa） Chain L 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
8PEO H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex Deposited 2023-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain K 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.69 Å
8PEP H3K36me2 nucleosome-LEDGF/p75 PWWP domain complex - pose 2 Deposited 2023-06-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: 12-meric	Chain K 1–530（530 aa） Chain L 1–530（530 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.33 Å
9BW9 Tetrameric Complex of full-length HIV-1 integrase protein bound to the integrase binding domain of LEDGF/p75 Deposited 2024-05-21	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 347–435（89 aa） Chain F 347–435（89 aa） Chain G 347–435（89 aa） Chain H 347–435（89 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6 cryo-EM vitrification conditions Cryogen ETHANE；Cryo-EM grids were prepared by freezing using a manual plunger in cold room at 4C	Resolution 4.10 Å
9XYC Pol II-DSIF-SPT6-PAF1c-TFIIS-IWS1-ELOF1-LEDGF-nucleosome LEDGF+nucleosome map Q Deposited 2025-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: undecameric	Chain l 2–530（529 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å

34 other PDB entries and 54 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PSIP1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–88； UniProt 348–435 Author chain F； PDBConstruct 1–88； UniProt 348–435 Author chain G； PDBConstruct 1–88； UniProt 348–435 Author chain H； PDBConstruct 1–88； UniProt 348–435

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3hph
Deposition date deposition_date	2009-06-04
Structure title title	Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD
Keywords keywords	;PROTEIN-PROTEIN COMPLEX, TETRAMER, DNA INTEGRATION, ENDONUCLEASE, MAGNESIUM, METAL-BINDING, MULTIFUNCTIONAL ENZYME, NUCLEASE, NUCLEOTIDYLTRANSFERASE, NUCLEUS, TRANSFERASE, VIRAL NUCLEOPROTEIN, VIRION, DNA-BINDING, HOST-VIRUS INTERACTION, TRANSCRIPTION, TRANSCRIPTION REGULATION, ZINC BINDING, HHCC MOTIF, VIRAL PROTEIN, RECOMBINATION ;; TRANSFERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	37.01 Å
Radius of gyration Rg (electron density) rg_electron	37.03 Å
Forward intensity I(0) i0	234249000.00
Molecular weight molecular_weight	123550.0 kDa
Excluded volume excluded_volume	154680 Å³
Envelope volume envelope_volume	207100 Å³
Hydration-shell volume shell_volume	48111 Å³
Envelope diameter envelope_diameter	160.6 Å
Shell Rg shell_rg	41.33 Å
Envelope Rg envelope_rg	38.08 Å
Shape Rg shape_rg	36.96 Å
Total Rg total_rg	37.54 Å
Total atoms total_atoms	8668
Residues n_residues	1086
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	149.5 Å
Rg (real space) rg_real	37.24 Å
Rg uncertainty (real space) rg_real_error	2.29 Å
I(0) (real space) i0_real	2.3420e+08
I(0) uncertainty (real space) i0_real_error	5.1630e+06
Rg (reciprocal space) rg_reciprocal	37.09 Å
I(0) (reciprocal space) i0_reciprocal	234200000.0000
Solution quality estimate total_estimate	0.6885
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	38.2 Å
Skewness Skewness skewness	0.569
Kurtosis Kurtosis kurtosis	0.179
Angular range angular_range	— – 0.2150 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	48560000.0000
Real-space data points n_real_points	44
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.472; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.531; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Integrase
Molecular weight formula_weight	25090.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	8778

MVENIPLAEEEHNKWHQDAVSLHLEFGIPRTAAEDIVQQCDVCQENKMPSTLRGSNKRGIDHWQVDYTHYEDKIILVWVETNSGLIYAERVKGETGQEFRVQTMKWYAMFAPKSLQSDNGPAFVAESTQLLMKYLGIEHTTGIPWNPQSQALVERTHQTLKNTLEKLIPMFNAFESALAGTLITLNIKRKGGLGTSPMDIFIFNKEQQRIQQQSKSKQE

来源 Source

来源生物 organism	Maedi visna virus
通用名 common_name	MVV
NCBI Class编号 ncbi_taxonomy_id	36374
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PC4 and SFRS1-interacting protein
Molecular weight formula_weight	10988.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

MDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVLEVLFQ

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	110

▼

7. Fold Classification (SCOP + CATH) 17 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d3hphe1
Class class	a — All alpha proteins
Fold Fold fold	a.48 — N-cbl like
Superfamily Superfamily superfamily	a.48.4 — HIV integrase-binding domain
Family Family family	a.48.4.1 — HIV integrase-binding domain

Domain ID domain_id	d3hphe2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3hphf_
Class class	a — All alpha proteins
Fold Fold fold	a.48 — N-cbl like
Superfamily Superfamily superfamily	a.48.4 — HIV integrase-binding domain
Family Family family	a.48.4.1 — HIV integrase-binding domain

Domain ID domain_id	d3hphg_
Class class	a — All alpha proteins
Fold Fold fold	a.48 — N-cbl like
Superfamily Superfamily superfamily	a.48.4 — HIV integrase-binding domain
Family Family family	a.48.4.1 — HIV integrase-binding domain

Domain ID domain_id	d3hphh1
Class class	a — All alpha proteins
Fold Fold fold	a.48 — N-cbl like
Superfamily Superfamily superfamily	a.48.4 — HIV integrase-binding domain
Family Family family	a.48.4.1 — HIV integrase-binding domain

Domain ID domain_id	d3hphh2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (11 domains)

Domain ID domain_id	3hphA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	200 — Integrase, N-terminal zinc-binding domain

Domain ID domain_id	3hphA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	10 — Ribonuclease H-like superfamily/Ribonuclease H

Domain ID domain_id	3hphB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	200 — Integrase, N-terminal zinc-binding domain

Domain ID domain_id	3hphB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	10 — Ribonuclease H-like superfamily/Ribonuclease H

Domain ID domain_id	3hphC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	200 — Integrase, N-terminal zinc-binding domain

Domain ID domain_id	3hphC02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	10 — Ribonuclease H-like superfamily/Ribonuclease H

Domain ID domain_id	3hphD01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	200 — Integrase, N-terminal zinc-binding domain

Domain ID domain_id	3hphD02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	10 — Ribonuclease H-like superfamily/Ribonuclease H

Domain ID domain_id	3hphE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	930 — Transcription Elongation Factor S-II; Chain A
Homologous superfamily homologous superfamily	10 — Conserved domain common to transcription factors TFIIS, elongin A, CRSP70

Domain ID domain_id	3hphF00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	930 — Transcription Elongation Factor S-II; Chain A
Homologous superfamily homologous superfamily	10 — Conserved domain common to transcription factors TFIIS, elongin A, CRSP70

Domain ID domain_id	3hphH00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	930 — Transcription Elongation Factor S-II; Chain A
Homologous superfamily homologous superfamily	10 — Conserved domain common to transcription factors TFIIS, elongin A, CRSP70

▶

8. Citations (2)

▶

Unit-cell length a length_a	102.870 Å
Unit-cell length b length_b	83.150 Å
Unit-cell length c length_c	115.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.96 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.640 Å
Low-resolution limit resolution_low	39.010 Å
R factor r_factor	0.2280
R_work r_work	0.2260
R_free r_free	0.2530

fit	/app/data/saxs_computation/hp/3hph/3hph.fit
pddf	/app/data/pr_computation/hp/3hph/3hph.pr.out
profile	/app/data/saxs_computation/hp/3hph/3hph.dat

Closed tetramer of Visna virus integrase (residues 1-219) in complex with LEDGF IBD

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrase

State in the Current Structure

Other States of the Same Protein in the Database

PC4 and SFRS1-interacting protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 17 domains

SCOP 2.08 (6 domains)

CATH v4.4 (11 domains)

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)