SAXSdb — 3imq

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

N utilization substance protein B

Escherichia coli K-12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	30S ribosomal protein S10 × 1 （P0A7R5） POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	30S ribosomal protein S10 × 1 （P0A7R5） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	30S ribosomal protein S10 × 1 （P0A7R5） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NUSB_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–141； UniProt 3–139 Author chain B； PDBConstruct 5–141； UniProt 3–139 Author chain C； PDBConstruct 5–141； UniProt 3–139

30S ribosomal protein S10

Escherichia coli K-12

UniProt P0A7R5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	N utilization substance protein B × 1 （P0A780） POTASSIUM ION × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	N utilization substance protein B × 1 （P0A780） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	N utilization substance protein B × 1 （P0A780） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 6–87； UniProt 1–103 Author chain K； PDBConstruct 6–87； UniProt 1–103 Author chain L； PDBConstruct 6–87； UniProt 1–103

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3imq
Deposition date deposition_date	2009-08-11
Structure title title	Crystal structure of the NusB101-S10(delta loop) complex
Keywords keywords	;Processive transcription antitermination; transcription termination; transcription factor; protein-protein interaction; protein-RNA interaction, RNA-binding, Transcription, Transcription regulation, Transcription termination, Ribonucleoprotein, Ribosomal protein, transcription regulator - ribosomal protein COMPLEX ;; transcription regulator / ribosomal protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3imq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3imq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3imq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.19 Å
Rg (electron density)	18.21 Å
Total Rg	19.26 Å
Atom count	1763
Residues	224
Excluded volume	31627 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3imq__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3imq__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3imq__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	N utilization substance protein B
Molecular weight formula_weight	15837.1 kDa
Mutation mutation	D118N
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	5475

GAMEPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAENSHKFVNGVLDKAAPVIRPNKK

Source Source

Source organism organism	Escherichia coli K-12
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	30S ribosomal protein S10
Molecular weight formula_weight	9608.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,L

GPLGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG

Source Source

Source organism organism	Escherichia coli K-12
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	155

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d3imqa_
Class class	a — All alpha proteins
Fold Fold fold	a.79 — NusB-like
Superfamily Superfamily superfamily	a.79.1 — NusB-like
Family Family family	a.79.1.1 — Antitermination factor NusB

Domain ID domain_id	d3imqb_
Class class	a — All alpha proteins
Fold Fold fold	a.79 — NusB-like
Superfamily Superfamily superfamily	a.79.1 — NusB-like
Family Family family	a.79.1.1 — Antitermination factor NusB

Domain ID domain_id	d3imqc_
Class class	a — All alpha proteins
Fold Fold fold	a.79 — NusB-like
Superfamily Superfamily superfamily	a.79.1 — NusB-like
Family Family family	a.79.1.1 — Antitermination factor NusB

CATH v4.4 (6 domains)

Domain ID domain_id	3imqA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	940 — N-utilizing Substance Protein B Homolog; Chain A
Homologous superfamily homologous superfamily	10 — NusB-like

Domain ID domain_id	3imqB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	940 — N-utilizing Substance Protein B Homolog; Chain A
Homologous superfamily homologous superfamily	10 — NusB-like

Domain ID domain_id	3imqC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	940 — N-utilizing Substance Protein B Homolog; Chain A
Homologous superfamily homologous superfamily	10 — NusB-like

Domain ID domain_id	3imqJ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	600 — Ribosomal protein S10

Domain ID domain_id	3imqK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	600 — Ribosomal protein S10

Domain ID domain_id	3imqL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	600 — Ribosomal protein S10

▶

Unit-cell length a length_a	112.630 Å
Unit-cell length b length_b	112.630 Å
Unit-cell length c length_c	263.200 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	I 41 2 2
Space-group number int_tables_number	98
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2069
R_work r_work	0.2043
R_free r_free	0.2558

Crystal structure of the NusB101-S10(delta loop) complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

N utilization substance protein B

State in the Current Structure

Other States of the Same Protein in the Database

30S ribosomal protein S10

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3imq__assembly_1__model_1

3imq__assembly_1__model_1 | I(q)

3imq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of the NusB101-S10(delta loop) complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

N utilization substance protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3imq__assembly_1__model_1

3imq__assembly_1__model_1 | I(q)

3imq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)