3k7r

Crystal structure of [TM][CuAtx1]3

Method: X-RAY DIFFRACTION D_max: 127.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Metal homeostasis factor ATX1

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 1–73 Chain B； UniProt 1–73 Chain C； UniProt 1–73	Not recorded	CU COPPER (II) ION × 4 4SM TETRATHIOMOLYBDATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256
2	Protein homooligomer Homooligomer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain D； UniProt 1–73 Chain E； UniProt 1–73 Chain F； UniProt 1–73	Not recorded	CU COPPER (II) ION × 4 4SM TETRATHIOMOLYBDATE × 1 MLT D-MALATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256
3	Protein homooligomer Homooligomer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain G； UniProt 1–73 Chain H； UniProt 1–73 Chain I； UniProt 1–73	Not recorded	CU COPPER (II) ION × 4 4SM TETRATHIOMOLYBDATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256
4	Protein homooligomer Homooligomer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain J； UniProt 1–73 Chain K； UniProt 1–73 Chain L； UniProt 1–73	Not recorded	CU COPPER (II) ION × 4 4SM TETRATHIOMOLYBDATE × 1 MLT D-MALATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256
5	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–73 Chain B； UniProt 1–73 Chain C； UniProt 1–73 Chain D； UniProt 1–73 Chain E； UniProt 1–73 Chain F； UniProt 1–73	Not recorded	CU COPPER (II) ION × 8 4SM TETRATHIOMOLYBDATE × 2 MLT D-MALATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256
6	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain G； UniProt 1–73 Chain H； UniProt 1–73 Chain I； UniProt 1–73 Chain J； UniProt 1–73 Chain K； UniProt 1–73 Chain L； UniProt 1–73	Not recorded	CU COPPER (II) ION × 8 4SM TETRATHIOMOLYBDATE × 2 MLT D-MALATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 7；287 K；0.15 M DL-Malic acid, pH 7.0, 20% PEG 3350, EVAPORATION, temperature 287K	Resolution 2.28 Å R-free 0.256

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3K7R	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CC7 CRYSTAL STRUCTURE OF THE ATX1 METALLOCHAPERONE PROTEIN Deposited 1999-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–73（73 aa）	Not recorded	BEN BENZAMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 1.20 Å R-free 0.211
1CC8 CRYSTAL STRUCTURE OF THE ATX1 METALLOCHAPERONE PROTEIN Deposited 1999-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–73（73 aa）	Not recorded	HG MERCURY (II) ION × 1 BEN BENZAMIDINE × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.0	Resolution 1.02 Å R-free 0.172
1FD8 SOLUTION STRUCTURE OF THE CU(I) FORM OF THE YEAST METALLOCHAPERONE, ATX1 Deposited 2000-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate；Pressure ambient NMR sample composition 1.8mM Cu(I)-Atx1 15N; 100mM phosphate buffer NA; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
1FES SOLUTION STRUCTURE OF THE APO FORM OF THE YEAST METALLOCHAPERONE, ATX1 Deposited 2000-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–73（73 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100mM phosphate；Pressure ambient NMR sample composition 1.8mM Apo-Atx1 15N; 100mM phosphate buffer NA; 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2GGP Solution structure of the Atx1-Cu(I)-Ccc2a complex Deposited 2006-03-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–73（73 aa） Fragment：HMA domain, residues 1-73	Not recorded	CU1 COPPER (I) ION × 1	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100 mM KPi；Pressure ambient NMR sample composition 1mM Atx1 U-15N,13C, 1mM Ccc2a unlabeled, 1mM Cu(I), 100mM KPi, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
5VDE Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form I Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–73（73 aa） Chain B 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.3；293 K；0.1 M HEPES (pH 7.3), 24% (W/v) PEG3350	Resolution 1.65 Å R-free 0.206
5VDE Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form I Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–73（73 aa） Chain D 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.3；293 K；0.1 M HEPES (pH 7.3), 24% (W/v) PEG3350	Resolution 1.65 Å R-free 0.206
5VDE Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form I Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–73（73 aa） Chain B 1–73（73 aa） Chain C 1–73（73 aa） Chain D 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.3；293 K；0.1 M HEPES (pH 7.3), 24% (W/v) PEG3350	Resolution 1.65 Å R-free 0.206
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–73（73 aa） Chain B 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–73（73 aa） Chain D 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 1–73（73 aa） Chain F 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–73（73 aa） Chain H 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–73（73 aa） Chain B 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 1–73（73 aa） Chain D 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242
5VDF Crystal Structure of Cu(I)-loaded yeast Atx1: Crystal Form II Deposited 2017-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 1–73（73 aa） Chain H 1–73（73 aa）	Not recorded	CU1 COPPER (I) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.9；293 K；0.1 M HEPES (pH 7.9), 20% (w/v) PEG3350	Resolution 1.93 Å R-free 0.242

7 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ATX1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–73； UniProt 1–73 Author chain B； PDBConstruct 1–73； UniProt 1–73 Author chain C； PDBConstruct 1–73； UniProt 1–73 Author chain D； PDBConstruct 1–73； UniProt 1–73 Author chain E； PDBConstruct 1–73； UniProt 1–73 Author chain F； PDBConstruct 1–73； UniProt 1–73 Author chain G； PDBConstruct 1–73； UniProt 1–73 Author chain H； PDBConstruct 1–73； UniProt 1–73 Author chain I； PDBConstruct 1–73； UniProt 1–73 Author chain J； PDBConstruct 1–73； UniProt 1–73 Author chain K； PDBConstruct 1–73； UniProt 1–73 Author chain L； PDBConstruct 1–73； UniProt 1–73

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3k7r
Deposition date deposition_date	2009-10-13
Structure title title	Crystal structure of [TM][CuAtx1]3
Keywords keywords	;ferredoxin-like fold, protein-metal-drug complex, Cu-Mo metal cluster, Chaperone, Copper transport, Ion transport, Metal-binding, Transport ;; CHAPERONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	39.02 Å
Radius of gyration Rg (electron density) rg_electron	39.51 Å
Forward intensity I(0) i0	140075000.00
Molecular weight molecular_weight	98364.0 kDa
Excluded volume excluded_volume	124150 Å³
Envelope volume envelope_volume	175990 Å³
Hydration-shell volume shell_volume	38048 Å³
Envelope diameter envelope_diameter	136.3 Å
Shell Rg shell_rg	44.29 Å
Envelope Rg envelope_rg	38.39 Å
Shape Rg shape_rg	39.64 Å
Total Rg total_rg	39.35 Å
Total atoms total_atoms	6794
Residues n_residues	855
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	127.8 Å
Rg (real space) rg_real	39.33 Å
Rg uncertainty (real space) rg_real_error	1.14 Å
I(0) (real space) i0_real	1.4010e+08
I(0) uncertainty (real space) i0_real_error	2.3530e+06
Rg (reciprocal space) rg_reciprocal	39.15 Å
I(0) (reciprocal space) i0_reciprocal	140000000.0000
Solution quality estimate total_estimate	0.8074
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	31.2 Å
Skewness Skewness skewness	0.326
Kurtosis Kurtosis kurtosis	-0.828
Angular range angular_range	— – 0.2050 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14530000.0000
Real-space data points n_real_points	42
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.682; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.757; Smooth: 0.689

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Metal homeostasis factor ATX1
Molecular weight formula_weight	8232.6 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	7163

MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;brewer's yeast,lager beer yeast,yeast ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 3 Entity 3 non-polymer

Description description	TETRATHIOMOLYBDATE
Molecular weight formula_weight	224.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	D-MALATE
Molecular weight formula_weight	134.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	363

▼

7. Fold Classification (SCOP + CATH) 24 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d3k7ra_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7re_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7ri_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rj_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

Domain ID domain_id	d3k7rl_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.17 — HMA, heavy metal-associated domain
Family Family family	d.58.17.1 — HMA, heavy metal-associated domain

CATH v4.4 (12 domains)

Domain ID domain_id	3k7rA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rF00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rG00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rH00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rI00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rJ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	3k7rL00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	100 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	109.887 Å
Unit-cell length b length_b	182.242 Å
Unit-cell length c length_c	52.722 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.280 Å
Low-resolution limit resolution_low	37.420 Å
R factor r_factor	0.2045
R_work r_work	0.2017
R_free r_free	0.2561

fit	/app/data/saxs_computation/k7/3k7r/3k7r.fit
pddf	/app/data/pr_computation/k7/3k7r/3k7r.pr.out
profile	/app/data/saxs_computation/k7/3k7r/3k7r.dat