SAXSdb — 3l4q

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

Influenza A virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Phosphatidylinositol 3-kinase regulatory subunit beta × 1 （P23726） GLYCEROL × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Phosphatidylinositol 3-kinase regulatory subunit beta × 1 （P23726） GLYCEROL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NS1_I34A1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 7–164； UniProt 73–230 Author chain B； PDBConstruct 7–164； UniProt 73–230

Phosphatidylinositol 3-kinase regulatory subunit beta

Bos taurus

UniProt P23726

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Non-structural protein 1 × 1 （P03496） GLYCEROL × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Non-structural protein 1 × 1 （P03496） GLYCEROL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P85B_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–170； UniProt 424–593 Author chain D； PDBConstruct 1–170； UniProt 424–593

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3l4q
Deposition date deposition_date	2009-12-21
Structure title title	Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein
Keywords keywords	PI3K, PHOSPHOINOSITIDE-3-KINASE, INFLUENZA VIRUS, NS1, Kinase, VIRAL PROTEIN-PROTEIN BINDING complex; VIRAL PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3l4q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3l4q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3l4q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.06 Å
Rg (electron density)	34.67 Å
Total Rg	34.69 Å
Atom count	2324
Residues	283
Excluded volume	41312 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3l4q__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3l4q__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Non-structural protein 1
Molecular weight formula_weight	18464.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4923

HHHHHHSDEALKMTMASVPASRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAWRSSNENGRPPLTPKQKREMAGTIRSEV

Source Source

Source organism organism	Influenza A virus
NCBI taxonomy ID ncbi_taxonomy_id	211044
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Phosphatidylinositol 3-kinase regulatory subunit beta
Molecular weight formula_weight	20625.2 kDa
Mutation mutation	C495S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

YQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKSSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGI

Source Source

Source organism organism	Bos taurus
Common name common_name	bovine
NCBI taxonomy ID ncbi_taxonomy_id	9913
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	281

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d3l4qa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

Domain ID domain_id	d3l4qb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.299 — Ns1 effector domain-like
Superfamily Superfamily superfamily	d.299.1 — Ns1 effector domain-like
Family Family family	d.299.1.1 — Ns1 effector domain-like

Domain ID domain_id	d3l4qc_
Class class	h — Coiled coil proteins
Fold Fold fold	h.4 — Antiparallel coiled-coil
Superfamily Superfamily superfamily	h.4.21 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like
Family Family family	h.4.21.1 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like

Domain ID domain_id	d3l4qd_
Class class	h — Coiled coil proteins
Fold Fold fold	h.4 — Antiparallel coiled-coil
Superfamily Superfamily superfamily	h.4.21 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like
Family Family family	h.4.21.1 — Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like

CATH v4.4 (4 domains)

Domain ID domain_id	3l4qA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

Domain ID domain_id	3l4qB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	330 — Influenza virus non-structural protein, effector domain

Domain ID domain_id	3l4qC00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1490 —

Domain ID domain_id	3l4qD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1490 —

▶

Unit-cell length a length_a	57.950 Å
Unit-cell length b length_b	98.670 Å
Unit-cell length c length_c	149.940 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	49.970 Å
R factor r_factor	0.2350
R_work r_work	0.2319
R_free r_free	0.2923

Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Phosphatidylinositol 3-kinase regulatory subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3l4q__assembly_1__model_1

3l4q__assembly_1__model_1 | I(q)

3l4q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structural insights into phosphoinositide 3-kinase activation by the influenza A virus NS1 protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phosphatidylinositol 3-kinase regulatory subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3l4q__assembly_1__model_1

3l4q__assembly_1__model_1 | I(q)

3l4q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (1)