SAXSdb — 3m4w

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sigma-E factor regulatory protein rseB

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor negative regulatory protein × 2 （P0AFX7） ZINC ION × 3 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor negative regulatory protein × 2 （P0AFX7） ZINC ION × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSEB_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–295； UniProt 24–318 Author chain B； PDBConstruct 1–295； UniProt 24–318 Author chain C； PDBConstruct 1–295； UniProt 24–318 Author chain D； PDBConstruct 1–295； UniProt 24–318

Sigma-E factor negative regulatory protein

Escherichia coli

UniProt P0AFX7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor regulatory protein rseB × 2 （P0AFX9） ZINC ION × 3 water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Sigma-E factor regulatory protein rseB × 2 （P0AFX9） ZINC ION × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSEA_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–96； UniProt 121–216 Author chain F； PDBConstruct 1–96； UniProt 121–216 Author chain G； PDBConstruct 1–96； UniProt 121–216 Author chain H； PDBConstruct 1–96； UniProt 121–216

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3m4w
Deposition date deposition_date	2010-03-12
Structure title title	Structural basis for the negative regulation of bacterial stress response by RseB
Keywords keywords	;RseA, RseB, RseP, stress response, sigma factor, Periplasm, Cell membrane, Transmembrane, Signaling Protein-Signaling Protein complex ;; Signaling Protein/Signaling Protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3m4w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3m4w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3m4w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.97 Å
Rg (electron density)	28.11 Å
Total Rg	28.74 Å
Atom count	5113
Residues	638
Excluded volume	90749 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3m4w__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3m4w__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Sigma-E factor regulatory protein rseB
Molecular weight formula_weight	33328.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	10535

TPASGALLQQMNLASQSLNYELSFISINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFKRLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTESKLPMRVDLLDRDGETLEQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKAKFSWTPTWLPQGFSEVSSSRRPLPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGELPPQTAKRIAENIKFGAAQ

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Sigma-E factor negative regulatory protein
Molecular weight formula_weight	10718.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	83333
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	421

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3m4wA01
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	20 — outer membrane lipoprotein receptor (LolB), chain A
Homologous superfamily homologous superfamily	10 — Lipoprotein localisation LolA/LolB/LppX

Domain ID domain_id	3m4wB01
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	20 — outer membrane lipoprotein receptor (LolB), chain A
Homologous superfamily homologous superfamily	10 — Lipoprotein localisation LolA/LolB/LppX

Domain ID domain_id	3m4wC01
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	20 — outer membrane lipoprotein receptor (LolB), chain A
Homologous superfamily homologous superfamily	10 — Lipoprotein localisation LolA/LolB/LppX

Domain ID domain_id	3m4wD01
Class class	2 — Mainly Beta
Architecture architecture	50 — Clam
Topology topology	20 — outer membrane lipoprotein receptor (LolB), chain A
Homologous superfamily homologous superfamily	10 — Lipoprotein localisation LolA/LolB/LppX

Domain ID domain_id	3m4wE01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3960 —

Domain ID domain_id	3m4wF01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	3960 —

▶

Unit-cell length a length_a	87.097 Å
Unit-cell length b length_b	119.513 Å
Unit-cell length c length_c	150.866 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	19.980 Å
R factor r_factor	0.2390
R_work r_work	0.2390
R_free r_free	0.2720

Structural basis for the negative regulation of bacterial stress response by RseB

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sigma-E factor regulatory protein rseB

State in the Current Structure

Other States of the Same Protein in the Database

Sigma-E factor negative regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3m4w__assembly_1__model_1

3m4w__assembly_1__model_1 | I(q)

3m4w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Structural basis for the negative regulation of bacterial stress response by RseB

1. Protein Identity and Related Structures Protein Identity & Related Structures

Sigma-E factor regulatory protein rseB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sigma-E factor negative regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3m4w__assembly_1__model_1

3m4w__assembly_1__model_1 | I(q)

3m4w__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)