SAXSdb — 3ogn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Odorant-binding protein

Culex quinquefasciatus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	(1S)-1-[(2R)-6-oxotetrahydro-2H-pyran-2-yl]undecyl acetate × 1 MAGNESIUM ION × 3 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	(1S)-1-[(2R)-6-oxotetrahydro-2H-pyran-2-yl]undecyl acetate × 1 MAGNESIUM ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8T6I2_CULQU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–124； UniProt 26–149 Author chain B； PDBConstruct 1–124； UniProt 26–149

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ogn
Deposition date deposition_date	2010-08-17
Structure title title	Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone
Keywords keywords	helix bundle, Odorant-binding Protein, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ogn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ogn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ogn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.14 Å
Rg (electron density)	13.57 Å
Total Rg	14.92 Å
Atom count	1032
Residues	124
Excluded volume	18449 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ogn__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3ogn__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Odorant-binding protein
Molecular weight formula_weight	14396.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2601

VTPRRDAEYPPPELLEALKPLHDICAKKTGVTDEAIIEFSDGKIHEDEKLKCYMNCLFHEAKVVDDNGDVHLEKLHDSLPNSMHDIAMHMGKRCLYPEGENLCEKAFWLHKCWKQADPKHYFLV

Source Source

Source organism organism	Culex quinquefasciatus
Common name common_name	Southern house mosquito
NCBI taxonomy ID ncbi_taxonomy_id	7176
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	(1S)-1-[(2R)-6-oxotetrahydro-2H-pyran-2-yl]undecyl acetate
Molecular weight formula_weight	312.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	419

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3ogna_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.2 — Insect pheromone/odorant-binding proteins
Family Family family	a.39.2.0 — automated matches

Domain ID domain_id	d3ognb_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.2 — Insect pheromone/odorant-binding proteins
Family Family family	a.39.2.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	3ognA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	20 — Pheromone/general odorant binding protein domain

Domain ID domain_id	3ognB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	20 — Pheromone/general odorant binding protein domain

▶

Unit-cell length a length_a	35.915 Å
Unit-cell length b length_b	107.310 Å
Unit-cell length c length_c	38.529 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.38 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	26.830 Å
R factor r_factor	0.1341
R_work r_work	0.1320
R_free r_free	0.1737

Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone

1. Protein Identity and Related Structures Protein Identity & Related Structures

Odorant-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ogn__assembly_1__model_1

3ogn__assembly_1__model_1 | I(q)

3ogn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Crystal Structure of an Odorant-binding Protein from the Southern House Mosquito Complexed with an Oviposition Pheromone

1. Protein Identity and Related Structures Protein Identity & Related Structures

Odorant-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ogn__assembly_1__model_1

3ogn__assembly_1__model_1 | I(q)

3ogn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)