SAXSdb — 3rrr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

Human respiratory syncytial virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 6	2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q84850_HRSV
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–84； UniProt 26–109 Author chain C； PDBConstruct 1–84； UniProt 26–109 Author chain E； PDBConstruct 1–84； UniProt 26–109 Author chain G； PDBConstruct 1–84； UniProt 26–109 Author chain I； PDBConstruct 1–84； UniProt 26–109 Author chain M； PDBConstruct 1–84； UniProt 26–109 Author chain B； PDBConstruct 1–367； UniProt 147–513 Author chain D； PDBConstruct 1–367； UniProt 147–513 Author chain F； PDBConstruct 1–367； UniProt 147–513 Author chain H； PDBConstruct 1–367； UniProt 147–513 Author chain L； PDBConstruct 1–367； UniProt 147–513 Author chain N； PDBConstruct 1–367； UniProt 147–513

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3rrr
Deposition date deposition_date	2011-04-30
Structure title title	Structure of the RSV F protein in the post-fusion conformation
Keywords keywords	six-helix bundle, membrane fusion, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3rrr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3rrr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3rrr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.88 Å
Rg (electron density)	46.67 Å
Total Rg	46.58 Å
Atom count	20146
Residues	1282
Excluded volume	180700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3rrr__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3rrr__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0
Molecular weight formula_weight	9529.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,M
Atom count atom_count	40311

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARR

Source Source

Source organism organism	Human respiratory syncytial virus
NCBI taxonomy ID ncbi_taxonomy_id	12814
Host organism host_organism	homo sapiens

Entity 2 Entity 2 polymer

Description description	Fusion glycoprotein F0
Molecular weight formula_weight	41323.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,L,N

AIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLGLEVLFQ

Source Source

Source organism organism	Human respiratory syncytial virus
NCBI taxonomy ID ncbi_taxonomy_id	12814
Host organism host_organism	homo sapiens

Entity 3 Entity 3 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	12

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3rrrG01
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	370 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	3rrrG02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1160 —

Domain ID domain_id	3rrrI01
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	370 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	3rrrI02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1160 —

Domain ID domain_id	3rrrM01
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	370 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	50 —

Domain ID domain_id	3rrrM02
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	250 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	1160 —

▶

Unit-cell length a length_a	113.170 Å
Unit-cell length b length_b	131.500 Å
Unit-cell length c length_c	164.280 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	103.17 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.821 Å
Low-resolution limit resolution_low	44.209 Å
R factor r_factor	0.2233
R_work r_work	0.2213
R_free r_free	0.2621

Structure of the RSV F protein in the post-fusion conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3rrr__assembly_1__model_1

3rrr__assembly_1__model_1 | I(q)

3rrr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Structure of the RSV F protein in the post-fusion conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3rrr__assembly_1__model_1

3rrr__assembly_1__model_1 | I(q)

3rrr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)