3rvo

Structure of CheY-Mn2+ Complex with substitutions at 59 and 89: N59D E89Y

Method: X-RAY DIFFRACTION D_max: 45.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chemotaxis protein CheY

Escherichia coli

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 1–129	Mutation：N59D, E89Y	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 8000 30%, Na Cacodylate 100mM pH 6.0, Calcium Acetate 120mM, Glycerol 10% (v/v), 8.9 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.55 Å R-free 0.185

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3RVO	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1E6K Two-component signal transduction system D12A mutant of CheY Deposited 2000-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：D12A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；pH 7.00	Resolution 2.00 Å R-free 0.260
1E6L Two-component signal transduction system D13A mutant of CheY Deposited 2000-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–129（127 aa）	Mutation：D13A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；pH 7.00	Resolution 1.90 Å R-free 0.270
1E6M TWO-COMPONENT SIGNAL TRANSDUCTION SYSTEM D57A MUTANT OF CHEY Deposited 2000-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；pH 7.00	Resolution 1.70 Å R-free 0.260
1JBE 1.08 A Structure of apo-Chey reveals meta-active conformation Deposited 2001-06-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 3 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions MICRODIALYSIS；pH 8.3；293 K；microdialysis, 2.2M Ammonium sulfate, 50mM Tris, pH 8.3, MICRODIALYSIS, temperature 293K	Resolution 1.08 Å R-free 0.152
2B1J Crystal Structure of Unphosphorylated CheY Bound to the N-Terminus of FliM Deposited 2005-09-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 6000, magnesium chloride, MES buffer, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.240
2B1J Crystal Structure of Unphosphorylated CheY Bound to the N-Terminus of FliM Deposited 2005-09-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–128（128 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 6000, magnesium chloride, MES buffer, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.240
2ID7 1.75 A Structure of T87I Phosphono-CheY Deposited 2006-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Mutation：D57(CyQ) T87I Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；28% PEG 3200, 0.2M ammonium chloride, 0.1M sodium acetate, pH 4.60, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.75 Å R-free 0.202
2ID9 1.85 A Structure of T87I/Y106W Phosphono-CheY Deposited 2006-09-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Mutation：D57(CyQ) T87I Y106W Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.84；298 K；20% PEG 8000, 0.2 M ammonium acetate, 0.1 M MES-NaOH, pH 5.84, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.75 Å R-free 0.202
2IDM 2.00 A Structure of T87I/Y106W Phosphono-CheY Deposited 2006-09-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–128（128 aa）	Mutation：D57(CyQ) T87I Y106W Non-standard monomer：Yes (specific site not provided by mmCIF)	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.88；298 K；20% PEG 8000, 0.2M ammonium acetate, 0.1 M MES-NaOH, pH 5.88, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.00 Å R-free 0.328
2LP4 Solution structure of P1-CheY/P2 complex in bacterial chemotaxis Deposited 2012-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Y 2–129（128 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 0.05；Pressure ambient NMR sample composition 200 mM [U-15N; U-2H] CheY, 3000 mM [U-2H] CheA P1, 250 mM [U-2H] CheA P2, 92% H2O/8% D2O \| 92% H2O/8% D2O	Resolution not provided
3F7N Crystal Structure of CheY triple mutant F14E, N59M, E89L complexed with BeF3- and Mn2+ Deposited 2008-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：F14E, N59M, E89L	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.219
3F7N Crystal Structure of CheY triple mutant F14E, N59M, E89L complexed with BeF3- and Mn2+ Deposited 2008-11-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–129（128 aa）	Mutation：F14E, N59M, E89L	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.219
3FFT Crystal Structure of CheY double mutant F14E, E89R complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：F14E, E89R	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.21 Å R-free 0.203
3FFT Crystal Structure of CheY double mutant F14E, E89R complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–129（128 aa）	Mutation：F14E, E89R	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.21 Å R-free 0.203
3FFW Crystal Structure of CheY triple mutant F14Q, N59K, E89Y complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：F14Q, N59K, E89Y	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.206
3FFW Crystal Structure of CheY triple mutant F14Q, N59K, E89Y complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–129（128 aa）	Mutation：F14Q, N59K, E89Y	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.206
3FFX Crystal Structure of CheY triple mutant F14E, N59R, E89H complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：F14E, N59R, E89H	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.01 Å R-free 0.210
3FFX Crystal Structure of CheY triple mutant F14E, N59R, E89H complexed with BeF3- and Mn2+ Deposited 2008-12-04	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–129（128 aa）	Mutation：F14E, N59R, E89H	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.01 Å R-free 0.210
3FGZ Crystal Structure of CheY triple mutant F14E, N59M, E89R complexed with BeF3- and Mn2+ Deposited 2008-12-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–129（128 aa）	Mutation：F14E, N59M, E89R	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, vapor diffusion, hanging drop, temperature 298K	Resolution 2.00 Å R-free 0.220
3FGZ Crystal Structure of CheY triple mutant F14E, N59M, E89R complexed with BeF3- and Mn2+ Deposited 2008-12-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–129（128 aa）	Mutation：F14E, N59M, E89R	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GOL GLYCEROL × 1 NH4 AMMONIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；298 K；Tris buffer, Ammonium Sulfate, Glycerol, BeCl2, NaF, MnCl2, pH 8.4, vapor diffusion, hanging drop, temperature 298K	Resolution 2.00 Å R-free 0.220
3MYY Structure of E. Coli CheY mutant A113P bound to Beryllium fluoride Deposited 2010-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–129（128 aa） Fragment：CheY Chain B 2–129（128 aa） Fragment：CheY	Mutation：A113P Mutation：A113P	BEF BERYLLIUM TRIFLUORIDE ION × 4 MN MANGANESE (II) ION × 6 GOL GLYCEROL × 7 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Ammonium Sulfate 1.8-2.4 M, Glycerol 0-12.5% (v/v), Tris 100 mM, pH 7.0-8.5, MnCl2 20mM, BeCl2 1mM, NaF 10mM, , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.202
3OLV Structural and functional effects of substitution at position T+1 in CheY: CheYA88V-BeF3-Mg complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：A88V	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Ammonium Sulfate 1.7 M Glycerol 5% (v/v) Tris 100 mM pH 8.0 MnCl2 20mM BeCl2 1mM NaF 10mM, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.209
3OLV Structural and functional effects of substitution at position T+1 in CheY: CheYA88V-BeF3-Mg complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：A88V	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Ammonium Sulfate 1.7 M Glycerol 5% (v/v) Tris 100 mM pH 8.0 MnCl2 20mM BeCl2 1mM NaF 10mM, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.209
3OLW Structural and functional effects of substitution at position T+1 in CheY: CheYA88T-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：A88T	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 2 GOL GLYCEROL × 4 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；Ammonium Sulfate 2.4 M Glycerol 5.0% (v/v) Tris 100 mM pH 7.5 MnCl2 20mM BeCl2 1mM NaF 10mM 10.1 mg/mL CheY A88M 2-19-10, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.222
3OLW Structural and functional effects of substitution at position T+1 in CheY: CheYA88T-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：A88T	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 2 GOL GLYCEROL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；Ammonium Sulfate 2.4 M Glycerol 5.0% (v/v) Tris 100 mM pH 7.5 MnCl2 20mM BeCl2 1mM NaF 10mM 10.1 mg/mL CheY A88M 2-19-10, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.222
3OLX Structural and functional effects of substitution at position T+1 in CheY: CheYA88S-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：A88S	BEF BERYLLIUM TRIFLUORIDE ION × 2 MN MANGANESE (II) ION × 2 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Ammonium Sulfate 2.4 M Glycerol 5% (v/v) Tris 100 mM pH 7.5-8.5 MnCl2 20mM BeCl2 1mM NaF 10mM 7.2 mg/mL CheY A88S 2-15-10 , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3OLX Structural and functional effects of substitution at position T+1 in CheY: CheYA88S-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：A88S	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Ammonium Sulfate 2.4 M Glycerol 5% (v/v) Tris 100 mM pH 7.5-8.5 MnCl2 20mM BeCl2 1mM NaF 10mM 7.2 mg/mL CheY A88S 2-15-10 , VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.230
3OLY Structural and functional effects of substitution at position T+1 in CheY: CheYA88M-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：A88M	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Ammonium Sulfate 2.4 M Glycerol 2.5% (v/v) Tris 100 mM pH 8.0 MnCl2 20mM BeCl2 1mM NaF 10mM 4.8 mg/mL CheY A88M 1-10-10, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.05 Å R-free 0.212
3OLY Structural and functional effects of substitution at position T+1 in CheY: CheYA88M-BeF3-Mn complex Deposited 2010-08-26	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：A88M	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 3 GOL GLYCEROL × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Ammonium Sulfate 2.4 M Glycerol 2.5% (v/v) Tris 100 mM pH 8.0 MnCl2 20mM BeCl2 1mM NaF 10mM 4.8 mg/mL CheY A88M 1-10-10, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.05 Å R-free 0.212
3OO0 Structure of apo CheY A113P Deposited 2010-08-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa） Fragment：CheY	Mutation：A113P	GOL GLYCEROL × 4 MN MANGANESE (II) ION × 1 NH4 AMMONIUM ION × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.2 M Tris 50 mM pH 8.25, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.55 Å R-free 0.199
3OO0 Structure of apo CheY A113P Deposited 2010-08-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa） Fragment：CheY	Mutation：A113P	GOL GLYCEROL × 3 MN MANGANESE (II) ION × 1 NH4 AMMONIUM ION × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.2 M Tris 50 mM pH 8.25, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.55 Å R-free 0.199
3OO1 Structure of E. Coli CheY mutant A113P in the absence of Sulfate Deposited 2010-08-30	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：A113P	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；28% PEG 8000 100 mM Na Cacodylate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.199
3OO1 Structure of E. Coli CheY mutant A113P in the absence of Sulfate Deposited 2010-08-30	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：A113P	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；28% PEG 8000 100 mM Na Cacodylate pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.199
3RVJ Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89Q Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89Q	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.4M, Tris 100mM pH 8.25, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.201
3RVJ Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89Q Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89Q	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.4M, Tris 100mM pH 8.25, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.201
3RVK Structure of the CheY-Mn2+ Complex with substitutions at 59 and 89: N59D E89Q Deposited 2011-05-06	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89Q	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 8000 31% (w/v), Na Cacodylate 100mM, pH 6.0, Calcium Acetate 140mM, Glycerol 10% (v/v), 8.8 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.16 Å R-free 0.159
3RVL Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89R Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89R	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.5M, Tris 100mM pH 8.25, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, 4.25mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.55 Å R-free 0.182
3RVL Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89R Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89R	BEF BERYLLIUM TRIFLUORIDE ION × 1 MN MANGANESE (II) ION × 2 SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.5M, Tris 100mM pH 8.25, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, 4.25mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.55 Å R-free 0.182
3RVM Structure of the CheY-Mn2+ Complex with substitutions at 59 and 89: N59D and E89R Deposited 2011-05-06	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89R	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；PEG 8000 26%, Na Cacodylate 100mM pH 6.0, Calcium Acetate 120mM, Glycerol 10% (v/v), 4.25 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.166
3RVN Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89Y Deposited 2011-05-06	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89Y	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.0M Tris 100mM pH 8.25 Glycerol 5% (v/v) MnCl2 20mM BeCl2 1mM NaF 10mM CheY 8.9mg/mL, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.25 Å R-free 0.225
3RVN Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89Y Deposited 2011-05-06	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89Y	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；Ammonium Sulfate 2.0M Tris 100mM pH 8.25 Glycerol 5% (v/v) MnCl2 20mM BeCl2 1mM NaF 10mM CheY 8.9mg/mL, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.25 Å R-free 0.225
3RVP Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89K Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89K	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 3 GOL GLYCEROL × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；Ammonium Sulfate 2.6M, Tris 100mM pH 7.5, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, 4.6mg/mL, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.215
3RVP Structure of the CheY-BeF3 Complex with substitutions at 59 and 89: N59D and E89K Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89K	MN MANGANESE (II) ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 SO4 SULFATE ION × 3 GOL GLYCEROL × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；Ammonium Sulfate 2.6M, Tris 100mM pH 7.5, Glycerol 5% (v/v), MnCl2 20mM, BeCl2 1mM, NaF 10mM, 4.6mg/mL, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.215
3RVQ Structure of the CheY-Mn2+ Complex with substitutions at 59 and 89: N59D E89K Deposited 2011-05-06	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89K	MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；PEG 8000 28% (w/v), Na Cacodylate 100 mM pH 6.0, Calcium Acetate 120mM, Glycerol 10% (v/v), 4.6 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.15 Å R-free 0.125
3RVR Structure of the CheYN59D/E89R Molybdate complex Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89R	MN MANGANESE (II) ION × 1 MOO MOLYBDATE ION × 1 SO4 SULFATE ION × 4 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2.45 M Ammonium Sulfate, 100 mM Tris, pH 7.5, 5% (v/v) Glycerol, 2 mM Ammonium Molybdate, 20mM Manganese chloride, 4.25 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.188
3RVR Structure of the CheYN59D/E89R Molybdate complex Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89R	MN MANGANESE (II) ION × 1 MOO MOLYBDATE ION × 1 SO4 SULFATE ION × 7 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2.45 M Ammonium Sulfate, 100 mM Tris, pH 7.5, 5% (v/v) Glycerol, 2 mM Ammonium Molybdate, 20mM Manganese chloride, 4.25 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.188
3RVS Structure of the CheYN59D/E89R Tungstate complex Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–129（129 aa）	Mutation：N59D, E89R	MN MANGANESE (II) ION × 1 WO4 TUNGSTATE(VI)ION × 1 SO4 SULFATE ION × 3 GOL GLYCEROL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2.6 M Ammonium Sulfate, 100 mM Tris, pH 7.5, 5% (v/v) glycerol, 10 mM Sodium Tungstate, 20 mM Manganese chloride, 4.25 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.184
3RVS Structure of the CheYN59D/E89R Tungstate complex Deposited 2011-05-06	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–129（129 aa）	Mutation：N59D, E89R	MN MANGANESE (II) ION × 1 WO4 TUNGSTATE(VI)ION × 1 SO4 SULFATE ION × 5 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；2.6 M Ammonium Sulfate, 100 mM Tris, pH 7.5, 5% (v/v) glycerol, 10 mM Sodium Tungstate, 20 mM Manganese chloride, 4.25 mg/mL CheY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.184

30 other PDB entries and 48 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CHEY_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–132； UniProt 1–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3rvo
Deposition date deposition_date	2011-05-06
Structure title title	Structure of CheY-Mn2+ Complex with substitutions at 59 and 89: N59D E89Y
Keywords keywords	;two-component, signal transduction, response regulator, CheY, Beta-alpha protein, chemotaxis, CheZ, CheX, CheA, phosphorylation, SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.95 Å
Radius of gyration Rg (electron density) rg_electron	13.43 Å
Forward intensity I(0) i0	3887550.00
Molecular weight molecular_weight	14183.0 kDa
Excluded volume excluded_volume	17921 Å³
Envelope volume envelope_volume	19635 Å³
Hydration-shell volume shell_volume	12265 Å³
Envelope diameter envelope_diameter	44.6 Å
Shell Rg shell_rg	19.41 Å
Envelope Rg envelope_rg	13.71 Å
Shape Rg shape_rg	13.42 Å
Total Rg total_rg	14.77 Å
Total atoms total_atoms	2000
Residues n_residues	129
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	45.9 Å
Rg (real space) rg_real	14.81 Å
Rg uncertainty (real space) rg_real_error	0.27 Å
I(0) (real space) i0_real	3.8880e+06
I(0) uncertainty (real space) i0_real_error	4.0710e+04
Rg (reciprocal space) rg_reciprocal	14.82 Å
I(0) (reciprocal space) i0_reciprocal	3888000.0000
Solution quality estimate total_estimate	0.8891
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	20.9 Å
Skewness Skewness skewness	-0.006
Kurtosis Kurtosis kurtosis	-0.424
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	770200.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.866; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.976; Smooth: 0.981

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Chemotaxis protein CheY
Molecular weight formula_weight	14429.7 kDa
Mutation mutation	N59D, E89Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2382

GSHMADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWDMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM

来源 Source

来源生物 organism	Escherichia coli
NCBI Class编号 ncbi_taxonomy_id	83333
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	174

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d3rvoa_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.23 — Flavodoxin-like
Superfamily Superfamily superfamily	c.23.1 — CheY-like
Family Family family	c.23.1.1 — CheY-related

CATH v4.4 (1 domains)

Domain ID domain_id	3rvoA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	2300 — Response regulator

▶

8. Citations (1)

▶

Unit-cell length a length_a	45.364 Å
Unit-cell length b length_b	46.885 Å
Unit-cell length c length_c	53.524 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.550 Å
Low-resolution limit resolution_low	23.442 Å
R factor r_factor	0.1537
R_work r_work	0.1521
R_free r_free	0.1852

fit	/app/data/saxs_computation/rv/3rvo/3rvo.fit
pddf	/app/data/pr_computation/rv/3rvo/3rvo.pr.out
profile	/app/data/saxs_computation/rv/3rvo/3rvo.dat