SAXSdb — 3sf4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

G-protein-signaling modulator 2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein inscuteable homolog × 1 （Q1MX18） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Protein inscuteable homolog × 1 （Q1MX18） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Protein inscuteable homolog × 1 （Q1MX18） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GPSM2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–406； UniProt 20–421 Author chain B； PDBConstruct 5–406； UniProt 20–421 Author chain C； PDBConstruct 5–406； UniProt 20–421

Protein inscuteable homolog

Homo sapiens

UniProt Q1MX18

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	G-protein-signaling modulator 2 × 1 （P81274） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	G-protein-signaling modulator 2 × 1 （P81274） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	G-protein-signaling modulator 2 × 1 （P81274） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INSC_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 6–52； UniProt 70–116 Author chain E； PDBConstruct 6–52； UniProt 70–116 Author chain F； PDBConstruct 6–52； UniProt 70–116

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3sf4
Deposition date deposition_date	2011-06-12
Structure title title	Crystal structure of the complex between the conserved cell polarity proteins Inscuteable and LGN
Keywords keywords	;tetratricopeptide repeat, TPR, cell polarity, asymmetric cell division, mitotic spindle orientation, Cytoplasm and cell cortex, SIGNALING PROTEIN-PROTEIN BINDING complex ;; SIGNALING PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3sf4__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3sf4__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3sf4__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.47 Å
Rg (electron density)	24.95 Å
Total Rg	25.70 Å
Atom count	3027
Residues	392
Excluded volume	53234 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3sf4__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3sf4__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`3sf4__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	G-protein-signaling modulator 2
Molecular weight formula_weight	44948.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	9330

GPGSMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Protein inscuteable homolog
Molecular weight formula_weight	5597.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

GPLGSMQVDSVQRWMEDLKLMTECECMCVLQAKPISLEEDAQGDLILAGGPG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	208

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	3sf4A00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	3sf4B00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	3sf4C00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

Domain ID domain_id	3sf4D00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	200 — Defensin A-like
Homologous superfamily homologous superfamily	10 — Inscuteable LGN-binding domain

Domain ID domain_id	3sf4E00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	200 — Defensin A-like
Homologous superfamily homologous superfamily	10 — Inscuteable LGN-binding domain

Domain ID domain_id	3sf4F00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	200 — Defensin A-like
Homologous superfamily homologous superfamily	10 — Inscuteable LGN-binding domain

▶

Unit-cell length a length_a	124.815 Å
Unit-cell length b length_b	124.815 Å
Unit-cell length c length_c	233.851 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	48.720 Å
R factor r_factor	0.2160
R_work r_work	0.2160
R_free r_free	0.2620

Crystal structure of the complex between the conserved cell polarity proteins Inscuteable and LGN

1. Protein Identity and Related Structures Protein Identity & Related Structures

G-protein-signaling modulator 2

State in the Current Structure

Other States of the Same Protein in the Database

Protein inscuteable homolog

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sf4__assembly_3__model_1

3sf4__assembly_3__model_1 | I(q)

3sf4__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Crystal structure of the complex between the conserved cell polarity proteins Inscuteable and LGN

1. Protein Identity and Related Structures Protein Identity & Related Structures

G-protein-signaling modulator 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein inscuteable homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3sf4__assembly_3__model_1

3sf4__assembly_3__model_1 | I(q)

3sf4__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)