SAXSdb — 3soh

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliM

Thermotoga maritima

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 46–233	Fragment：N-terminal domain (UNP residues 46-233)	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 46–233	Fragment：N-terminal domain (UNP residues 46-233)	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3SOH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2HP7 Structure of FliM provides insight into assembly of the switch complex in the bacterial flagella motor Deposited 2006-07-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 44–226（183 aa） Fragment：CheC-like domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；30-40% PEG 4K, 0.1M TrisHCL pH 8.5, 0.2 M sodium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298K X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；0.8 M Na K tartrate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.249
4FHR Crystal structure of the complex between the flagellar motor proteins FliG and FliM. Deposited 2012-06-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–230（185 aa） Fragment：Middle domain, UNP residues 46-230	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；50 mM calcium acetate, 0.1 M sodium cacodylate pH 6.0, and 25% v/v MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.243
4IGA The crystal structure of an activated Thermotoga maritima CheY with N-terminal region of FliM Deposited 2012-12-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–20（20 aa） Fragment：UNP RESIDUES 1-20	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；30% (w/v) PEG 4000, 0.1M TRIS pH 8.5, 0.2M sodium acetate, 0.2M lithium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.73 Å R-free 0.276
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Q 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain U 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 46–228（183 aa） Fragment：Middle domain, Chain A, C, E, G, I, K, M, O, Q, S, U	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291

4 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q9WZE6_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–188； UniProt 46–233 Author chain C； PDBConstruct 1–188； UniProt 46–233

Flagellar motor switch protein FliG

Thermotoga maritima

UniProt Q9WY63

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 117–193	Fragment：middle domain (UNP residues 117-193)	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 117–193	Fragment：middle domain (UNP residues 117-193)	Flagellar motor switch protein FliM × 1 （Q9WZE6）	X-RAY DIFFRACTION X-ray crystallization conditions：EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3SOH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1QC7 T. MARITIMA FLIG C-TERMINAL DOMAIN Deposited 1999-05-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 235–335（101 aa） Fragment：FLIG-C Chain B 235–335（101 aa） Fragment：FLIG-C	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；286 K；ISOPROPANOL, pH 5.2, temperature 286K	Resolution 2.20 Å R-free 0.304
3AJC Structure of the MC domain of FliG (PEV), a CW-biased mutant Deposited 2010-05-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 104–335（232 aa） Fragment：FliG MC domain, UNP residues 104-335	Mutation：deletion of UNP residues 170-172	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；50% PEG 200, 0.1M Phospho-Citrate, 0.2M NaCl, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
4FHR Crystal structure of the complex between the flagellar motor proteins FliG and FliM. Deposited 2012-06-06	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 115–327（213 aa） Fragment：Middle and C-terminal domains. UNP residues 115-327	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；50 mM calcium acetate, 0.1 M sodium cacodylate pH 6.0, and 25% v/v MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.243
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain V 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–98（98 aa） Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
5TDY Structure of cofolded FliFc:FliGn complex from Thermotoga maritima Deposited 2016-09-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–98（98 aa） Chain D 1–98（98 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217

6 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIG_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–80； UniProt 117–193 Author chain D； PDBConstruct 5–80； UniProt 117–193

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3soh
Deposition date deposition_date	2011-06-30
Structure title title	Architecture of the Flagellar Rotor
Keywords keywords	protein-protein complex, alpha/beta, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	27.01 Å
Radius of gyration Rg (electron density) rg_electron	26.09 Å
Forward intensity I(0) i0	54541500.00
Molecular weight molecular_weight	60702.0 kDa
Excluded volume excluded_volume	77235 Å³
Envelope volume envelope_volume	95580 Å³
Hydration-shell volume shell_volume	30724 Å³
Envelope diameter envelope_diameter	93.7 Å
Shell Rg shell_rg	33.22 Å
Envelope Rg envelope_rg	26.27 Å
Shape Rg shape_rg	26.08 Å
Total Rg total_rg	26.92 Å
Total atoms total_atoms	4284
Residues n_residues	536
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	92.6 Å
Rg (real space) rg_real	27.02 Å
Rg uncertainty (real space) rg_real_error	0.70 Å
I(0) (real space) i0_real	5.4540e+07
I(0) uncertainty (real space) i0_real_error	7.6180e+05
Rg (reciprocal space) rg_reciprocal	27.02 Å
I(0) (reciprocal space) i0_reciprocal	54540000.0000
Solution quality estimate total_estimate	0.8663
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	29.8 Å
Skewness Skewness skewness	0.386
Kurtosis Kurtosis kurtosis	-0.196
Angular range angular_range	— – 0.2950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	38800000.0000
Real-space data points n_real_points	60
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.801; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.942; Smooth: 0.912

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar motor switch protein FliM
Molecular weight formula_weight	21797.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	4285

KFSKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVETNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLSDRFWM

来源 Source

来源生物 organism	Thermotoga maritima
NCBI Class编号 ncbi_taxonomy_id	2336
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar motor switch protein FliG
Molecular weight formula_weight	8951.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GSHMVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFSRTFS

来源 Source

来源生物 organism	Thermotoga maritima
NCBI Class编号 ncbi_taxonomy_id	2336
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	3sohA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	3sohB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	30 — Flagellar motor switch protein FliG, alpha-alpha superhelical domain

Domain ID domain_id	3sohC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1550 — Chemotaxis protein chec
Homologous superfamily homologous superfamily	10 — CheC-like

Domain ID domain_id	3sohD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	220 — Annexin V; domain 1
Homologous superfamily homologous superfamily	30 — Flagellar motor switch protein FliG, alpha-alpha superhelical domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	91.390 Å
Unit-cell length b length_b	91.390 Å
Unit-cell length c length_c	226.520 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	26.210 Å
R factor r_factor	0.2530
R_work r_work	0.2530
R_free r_free	0.3010

fit	/app/data/saxs_computation/so/3soh/3soh.fit
pddf	/app/data/pr_computation/so/3soh/3soh.pr.out
profile	/app/data/saxs_computation/so/3soh/3soh.dat

Architecture of the Flagellar Rotor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar motor switch protein FliM

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein FliG

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)