SAXSdb — 5tdy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

Thermotoga maritima

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 497–532	Fragment：FliF C-terminal tail Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 497–532	Fragment：FliF C-terminal tail Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar motor switch protein FliG × 1 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
3	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 497–532 Chain C； UniProt 497–532	Fragment：FliF C-terminal tail Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar motor switch protein FliG × 2 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
4	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 497–532 Chain C； UniProt 497–532	Fragment：FliF C-terminal tail Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar motor switch protein FliG × 2 （Q9WY63）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	Q9WY64_THEMA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–37； UniProt 497–532 Author chain C； PDBConstruct 2–37； UniProt 497–532

Flagellar motor switch protein FliG

Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

UniProt Q9WY63

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–98	Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar M-ring protein × 1 （Q9WY64）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 1–98	Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar M-ring protein × 1 （Q9WY64）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
3	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–98 Chain D； UniProt 1–98	Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar M-ring protein × 2 （Q9WY64）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217
4	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–98 Chain D； UniProt 1–98	Non-standard monomer：Yes (specific site not provided by mmCIF)	Flagellar M-ring protein × 2 （Q9WY64）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；298 K；Wild Type: 100 mM HEPES pH 7.5, 25% (w/v) PEG3000, 200 mM sodium chloride Selenomethionine: 100 mm imidazole pH 7.2, 30% (w/v) PEG8000, 130 mM sodium chloride	Resolution 2.10 Å R-free 0.217

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5TDY	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1LKV Crystal Structure of the Middle and C-terminal Domains of the Flagellar Rotor Protein FliG Deposited 2002-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain X 104–335（232 aa） Fragment：RESIDUES 104-335	Not recorded	CA CALCIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；Isopropanol, CaCl2, sodium acetate, pluronic F-68, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.80 Å R-free 0.280
1QC7 T. MARITIMA FLIG C-TERMINAL DOMAIN Deposited 1999-05-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 235–335（101 aa） Fragment：FLIG-C Chain B 235–335（101 aa） Fragment：FLIG-C	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.2；286 K；ISOPROPANOL, pH 5.2, temperature 286K	Resolution 2.20 Å R-free 0.304
3AJC Structure of the MC domain of FliG (PEV), a CW-biased mutant Deposited 2010-05-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 104–335（232 aa） Fragment：FliG MC domain, UNP residues 104-335	Mutation：deletion of UNP residues 170-172	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；277 K；50% PEG 200, 0.1M Phospho-Citrate, 0.2M NaCl, pH 4.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.240
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 117–193（77 aa） Fragment：middle domain (UNP residues 117-193)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
3SOH Architecture of the Flagellar Rotor Deposited 2011-06-30	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 117–193（77 aa） Fragment：middle domain (UNP residues 117-193)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；0.1 M MES, pH 6.5, 10% dioxane, 1.6 M ammonium sulfate, EVAPORATION	Resolution 3.50 Å R-free 0.301
4FHR Crystal structure of the complex between the flagellar motor proteins FliG and FliM. Deposited 2012-06-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 115–327（213 aa） Fragment：Middle and C-terminal domains. UNP residues 115-327	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；50 mM calcium acetate, 0.1 M sodium cacodylate pH 6.0, and 25% v/v MPD, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.93 Å R-free 0.243
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain V 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291
4QRM crystal structure of a binary complex of FliM-FliG middle domains from T.maritima Deposited 2014-07-01	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 117–187（71 aa） Fragment：Middle domain, Chain B, D, F, H, J, L, N, P, R, T, V	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；0.1 M imidazole, pH 6.5, 1.2 M sodium acetate trihydrate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 4.32 Å R-free 0.291

6 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FLIG_THEMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–98； UniProt 1–98 Author chain D； PDBConstruct 1–98； UniProt 1–98

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5tdy
Deposition date deposition_date	2016-09-20
Structure title title	Structure of cofolded FliFc:FliGn complex from Thermotoga maritima
Keywords keywords	flagellar motor, switch complex, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.79 Å
Radius of gyration Rg (electron density) rg_electron	25.47 Å
Forward intensity I(0) i0	14681600.00
Molecular weight molecular_weight	29907.0 kDa
Excluded volume excluded_volume	37898 Å³
Envelope volume envelope_volume	51925 Å³
Hydration-shell volume shell_volume	19054 Å³
Envelope diameter envelope_diameter	101.3 Å
Shell Rg shell_rg	28.92 Å
Envelope Rg envelope_rg	26.09 Å
Shape Rg shape_rg	25.50 Å
Total Rg total_rg	25.85 Å
Total atoms total_atoms	2090
Residues n_residues	255
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	97.9 Å
Rg (real space) rg_real	26.11 Å
Rg uncertainty (real space) rg_real_error	0.98 Å
I(0) (real space) i0_real	1.4680e+07
I(0) uncertainty (real space) i0_real_error	2.0500e+05
Rg (reciprocal space) rg_reciprocal	26.01 Å
I(0) (reciprocal space) i0_reciprocal	14680000.0000
Solution quality estimate total_estimate	0.7845
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	25.3 Å
Skewness Skewness skewness	0.712
Kurtosis Kurtosis kurtosis	0.453
Angular range angular_range	— – 0.3100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2058000.0000
Real-space data points n_real_points	63
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.599; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.623; Smooth: 0.772

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Flagellar M-ring protein
Molecular weight formula_weight	5296.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	2263

MPEEKELLELLEELENIFSRSPSDIAEIVRLWFFERGLENLYF

来源 Source

来源生物 organism	Thermotoga maritima
NCBI Class编号 ncbi_taxonomy_id	243274
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Flagellar motor switch protein FliG
Molecular weight formula_weight	11156.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MPEKKIDGRRKAAVLLVALGPEKAAQVMKHLDEETVEQLVVEIANIGRVTPEEKKQVLEEFLSLAKAKEMISEGGIEYAKKVLEKAFGPERARKIIER

来源 Source

来源生物 organism	Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
NCBI Class编号 ncbi_taxonomy_id	243274
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	173

▶

8. Citations (1)

▶

Unit-cell length a length_a	49.180 Å
Unit-cell length b length_b	59.327 Å
Unit-cell length c length_c	51.722 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	115.59 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.105 Å
Low-resolution limit resolution_low	46.647 Å
R factor r_factor	0.1740
R_work r_work	0.1692
R_free r_free	0.2173

fit	/app/data/saxs_computation/td/5tdy/5tdy.fit
pddf	/app/data/pr_computation/td/5tdy/5tdy.pr.out
profile	/app/data/saxs_computation/td/5tdy/5tdy.dat

Structure of cofolded FliFc:FliGn complex from Thermotoga maritima

1. Protein Identity and Related Structures Protein Identity & Related Structures

Flagellar M-ring protein

State in the Current Structure

Other States of the Same Protein in the Database

Flagellar motor switch protein FliG

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)