3ssb

Structure of Insect Metalloproteinase Inhibitor in Complex with Thermolysin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thermolysin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Inducible metalloproteinase inhibitor protein × 1 （P82176） Inducible metalloproteinase inhibitor protein × 1 （P82176） GLYCEROL × 2 ZINC ION × 1 CALCIUM ION × 3 SODIUM ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Inducible metalloproteinase inhibitor protein × 1 （P82176） Inducible metalloproteinase inhibitor protein × 1 （P82176） GLYCEROL × 1 ZINC ION × 1 CALCIUM ION × 3 SODIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	THER_BACTH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–316； UniProt 233–548 Author chain B； PDBConstruct 1–316； UniProt 233–548

Inducible metalloproteinase inhibitor protein

Galleria mellonella

UniProt P82176

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Thermolysin × 1 （P00800） GLYCEROL × 2 ZINC ION × 1 CALCIUM ION × 3 SODIUM ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Thermolysin × 1 （P00800） GLYCEROL × 1 ZINC ION × 1 CALCIUM ION × 3 SODIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IMPI_GALME
Isoform	—
PDB entities	2, 3
Chains and sequence ranges	Author chain C； PDBConstruct 3–40； UniProt 19–56 Author chain D； PDBConstruct 3–40； UniProt 19–56 Author chain I； PDBConstruct 1–32； UniProt 57–88 Author chain J； PDBConstruct 1–32； UniProt 57–88

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3ssb
Deposition date deposition_date	2011-07-08
Structure title title	Structure of Insect Metalloproteinase Inhibitor in Complex with Thermolysin
Keywords keywords	;Thermolysin fold - Family I8 fold, Metalloprotease Thermolysin inhibitor, Zn Binding, Secreted, HYDROLASE-HYDROLASE INHIBITOR complex ;; HYDROLASE/HYDROLASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3ssb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3ssb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3ssb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.89 Å
Rg (electron density)	21.06 Å
Total Rg	21.97 Å
Atom count	2946
Residues	381
Excluded volume	51611 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3ssb__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3ssb__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Thermolysin
Molecular weight formula_weight	34360.3 kDa
EC 编号 ec_number	3.4.24.27
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	6494

ITGTSTVGVGRGVLGDQKNINTTYSTYYYLQDNTRGNGIFTYDAKYRTTLPGSLWADADNQFFASYDAPAVDAHYYAGVTYDYYKNVHNRLSYDGNNAAIRSSVHYSQGYNNAFWNGSQMVYGDGDGQTFIPLSGGIDVVAHELTHAVTDYTAGLIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINSGIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK

Entity 2 Entity 2 polymer

Description description	Inducible metalloproteinase inhibitor protein
Molecular weight formula_weight	4286.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

GMSIVLICNGGHEYYECGGACDNVCADLHIQNKTNCPIIN

Source Source

Source organism organism	Galleria mellonella
Common name common_name	Greater wax moth
NCBI taxonomy ID ncbi_taxonomy_id	7137
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Inducible metalloproteinase inhibitor protein
Molecular weight formula_weight	3684.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

IRCNDKCYCEDGYARDVNGKCIPIKDCPKIRS

Source Source

Source organism organism	Galleria mellonella
Common name common_name	Greater wax moth
NCBI taxonomy ID ncbi_taxonomy_id	7137
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	610

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3ssba_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.92 — Zincin-like
Superfamily Superfamily superfamily	d.92.1 — Metalloproteases ('zincins'), catalytic domain
Family Family family	d.92.1.2 — Thermolysin-like

Domain ID domain_id	d3ssbb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.92 — Zincin-like
Superfamily Superfamily superfamily	d.92.1 — Metalloproteases ('zincins'), catalytic domain
Family Family family	d.92.1.2 — Thermolysin-like

CATH v4.4 (4 domains)

Domain ID domain_id	3ssbA01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	170 — Elastase; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3ssbA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	390 — Neutral Protease; domain 2
Homologous superfamily homologous superfamily	10 — Neutral Protease Domain 2

Domain ID domain_id	3ssbB01
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	170 — Elastase; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	3ssbB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	390 — Neutral Protease; domain 2
Homologous superfamily homologous superfamily	10 — Neutral Protease Domain 2

▶

Unit-cell length a length_a	45.640 Å
Unit-cell length b length_b	78.370 Å
Unit-cell length c length_c	92.290 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.08 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1591
R_work r_work	0.1586
R_free r_free	0.1931

Structure of Insect Metalloproteinase Inhibitor in Complex with Thermolysin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thermolysin

State in the Current Structure

Other States of the Same Protein in the Database

Inducible metalloproteinase inhibitor protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ssb__assembly_1__model_1

3ssb__assembly_1__model_1 | I(q)

3ssb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Structure of Insect Metalloproteinase Inhibitor in Complex with Thermolysin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Thermolysin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inducible metalloproteinase inhibitor protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3ssb__assembly_1__model_1

3ssb__assembly_1__model_1 | I(q)

3ssb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)