3u6x

Phage TP901-1 baseplate tripod

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

BPP

Lactococcus phage TP901-1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	ORF48 × 3 （Q9AZ56） BROMIDE ION × 10 water × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	ORF48 × 3 （Q9AZ56） BROMIDE ION × 8 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9G096_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–163； UniProt 1–163 Author chain B； PDBConstruct 1–163； UniProt 1–163 Author chain C； PDBConstruct 1–163； UniProt 1–163 Author chain D； PDBConstruct 1–163； UniProt 1–163 Author chain E； PDBConstruct 1–163； UniProt 1–163 Author chain F； PDBConstruct 1–163； UniProt 1–163 Author chain G； PDBConstruct 1–163； UniProt 1–163 Author chain H； PDBConstruct 1–163； UniProt 1–163 Author chain I； PDBConstruct 1–163； UniProt 1–163 Author chain J； PDBConstruct 1–163； UniProt 1–163 Author chain K； PDBConstruct 1–163； UniProt 1–163 Author chain L； PDBConstruct 1–163； UniProt 1–163 Author chain M； PDBConstruct 1–163； UniProt 1–163 Author chain N； PDBConstruct 1–163； UniProt 1–163 Author chain O； PDBConstruct 1–163； UniProt 1–163 Author chain P； PDBConstruct 1–163； UniProt 1–163 Author chain Q； PDBConstruct 1–163； UniProt 1–163 Author chain R； PDBConstruct 1–163； UniProt 1–163

ORF48

Lactococcus phage TP901-1

UniProt Q9AZ56

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	BPP × 9 （Q9G096） BROMIDE ION × 10 water × 12	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 12	BPP × 9 （Q9G096） BROMIDE ION × 8 water × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9AZ56_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain S； PDBConstruct 1–105； UniProt 195–299 Author chain T； PDBConstruct 1–105； UniProt 195–299 Author chain U； PDBConstruct 1–105； UniProt 195–299 Author chain X； PDBConstruct 1–105； UniProt 195–299 Author chain Y； PDBConstruct 1–105； UniProt 195–299 Author chain Z； PDBConstruct 1–105； UniProt 195–299

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3u6x
Deposition date deposition_date	2011-10-13
Structure title title	Phage TP901-1 baseplate tripod
Keywords keywords	helix/beta, receptor binding complex, phage tail baseplate, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3u6x__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3u6x__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3u6x__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.38 Å
Rg (electron density)	45.10 Å
Total Rg	45.39 Å
Atom count	13291
Residues	1782
Excluded volume	235170 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3u6x__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3u6x__assembly_2__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	BPP
Molecular weight formula_weight	17303.4 kDa
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R
Atom count atom_count	30080

MASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDH

Source Source

Source organism organism	Lactococcus phage TP901-1
NCBI taxonomy ID ncbi_taxonomy_id	35345
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ORF48
Molecular weight formula_weight	11610.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U,X,Y,Z

GFKFVLEHDSEYQPEVKVTSYKNAIGTETDGFDSGPVFGGGTIYNVPVSLSYDRQKVYVEMPKSYTLAGDIILIDDGTLLVIKETQVLCFKMSDAKITKGYVFVA

Source Source

Source organism organism	Lactococcus phage TP901-1
NCBI taxonomy ID ncbi_taxonomy_id	35345
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	BROMIDE ION
Molecular weight formula_weight	79.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	3492

▼

6. Fold Classification (SCOP + CATH) 96 domains

SCOP 2.08 (54 domains)

Domain ID domain_id	d3u6xa1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xa2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xa3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xb1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xb2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xb3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xc1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xc2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xc3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xd1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xd2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xd3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xe1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xe2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xe3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xf1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xf2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xf3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xg1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xg2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xg3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xh1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xh2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xh3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xi1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xi2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xi3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xj1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xj2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xj3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xk1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xk2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xk3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xl1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xl2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xl3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xm1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xm2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xm3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xn1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xn2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xn3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xo1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xo2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xo3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xp1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xp2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xp3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xq1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xq2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xq3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3u6xr1
Class class	b — All beta proteins
Fold Fold fold	b.108 — Triple-stranded beta-helix
Superfamily Superfamily superfamily	b.108.1 — Phage fibre proteins
Family Family family	b.108.1.0 — automated matches

Domain ID domain_id	d3u6xr2
Class class	b — All beta proteins
Fold Fold fold	b.21 — Virus attachment protein globular domain
Superfamily Superfamily superfamily	b.21.1 — Virus attachment protein globular domain
Family Family family	b.21.1.3 — Lactophage receptor-binding protein head domain

Domain ID domain_id	d3u6xr3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (42 domains)

Domain ID domain_id	3u6xA01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xB01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xC01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xD01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xE01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xE02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xF01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xF02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xG01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xG02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xH01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xI01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xI02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xJ01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xJ02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xK01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xK02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xL01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xL02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xM01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xM02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xN01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xN02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xO01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xO02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xP01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xP02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xQ01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xQ02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xR01
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2190 —

Domain ID domain_id	3u6xR02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1830 — Phage tail base-plate Siphoviridae RBP, head domain

Domain ID domain_id	3u6xS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

Domain ID domain_id	3u6xT00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

Domain ID domain_id	3u6xU00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

Domain ID domain_id	3u6xX00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

Domain ID domain_id	3u6xY00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

Domain ID domain_id	3u6xZ00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	3320 —

▶

Unit-cell length a length_a	149.960 Å
Unit-cell length b length_b	237.420 Å
Unit-cell length c length_c	152.210 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	115.67 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	49.740 Å
R factor r_factor	0.1812
R_work r_work	0.1784
R_free r_free	0.2064

Phage TP901-1 baseplate tripod

1. Protein Identity and Related Structures Protein Identity & Related Structures

BPP

State in the Current Structure

Other States of the Same Protein in the Database

ORF48

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3u6x__assembly_2__model_1

3u6x__assembly_2__model_1 | I(q)

3u6x__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 96 domains

SCOP 2.08 (54 domains)

CATH v4.4 (42 domains)

7. Citations (1)

Phage TP901-1 baseplate tripod

1. Protein Identity and Related Structures Protein Identity & Related Structures

BPP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF48

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3u6x__assembly_2__model_1

3u6x__assembly_2__model_1 | I(q)

3u6x__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 96 domains

SCOP 2.08 (54 domains)

CATH v4.4 (42 domains)

7. Citations (1)