SAXSdb — 4v96

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF48

Lactococcus phage TP901-1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	ORF46 × 6 （Q9AZ58） BPP × 54 （Q9G096）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9AZ56_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–299； UniProt 1–299 Author chain AB； PDBConstruct 1–299； UniProt 1–299 Author chain AC； PDBConstruct 1–299； UniProt 1–299 Author chain AD； PDBConstruct 1–299； UniProt 1–299 Author chain AE； PDBConstruct 1–299； UniProt 1–299 Author chain AF； PDBConstruct 1–299； UniProt 1–299 Author chain AG； PDBConstruct 1–299； UniProt 1–299 Author chain AH； PDBConstruct 1–299； UniProt 1–299 Author chain AI； PDBConstruct 1–299； UniProt 1–299 Author chain AJ； PDBConstruct 1–299； UniProt 1–299 Author chain AK； PDBConstruct 1–299； UniProt 1–299 Author chain AL； PDBConstruct 1–299； UniProt 1–299 Author chain AM； PDBConstruct 1–299； UniProt 1–299 Author chain AN； PDBConstruct 1–299； UniProt 1–299 Author chain AO； PDBConstruct 1–299； UniProt 1–299 Author chain AP； PDBConstruct 1–299； UniProt 1–299 Author chain AQ； PDBConstruct 1–299； UniProt 1–299 Author chain AR； PDBConstruct 1–299； UniProt 1–299

ORF46

Lactococcus phage TP901-1

UniProt Q9AZ58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	ORF48 × 18 （Q9AZ56） BPP × 54 （Q9G096）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9AZ58_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AS； PDBConstruct 2–253； UniProt 2–253 Author chain AT； PDBConstruct 2–253； UniProt 2–253 Author chain AU； PDBConstruct 2–253； UniProt 2–253 Author chain AV； PDBConstruct 2–253； UniProt 2–253 Author chain AW； PDBConstruct 2–253； UniProt 2–253 Author chain AX； PDBConstruct 2–253； UniProt 2–253

BPP

Lactococcus phage TP901-1

UniProt Q9G096

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 78	ORF48 × 18 （Q9AZ56） ORF46 × 6 （Q9AZ58）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9G096_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B1； PDBConstruct 1–163； UniProt 1–163 Author chain B2； PDBConstruct 1–163； UniProt 1–163 Author chain BA； PDBConstruct 1–163； UniProt 1–163 Author chain BB； PDBConstruct 1–163； UniProt 1–163 Author chain BC； PDBConstruct 1–163； UniProt 1–163 Author chain BD； PDBConstruct 1–163； UniProt 1–163 Author chain BE； PDBConstruct 1–163； UniProt 1–163 Author chain BF； PDBConstruct 1–163； UniProt 1–163 Author chain BG； PDBConstruct 1–163； UniProt 1–163 Author chain BH； PDBConstruct 1–163； UniProt 1–163 Author chain BI； PDBConstruct 1–163； UniProt 1–163 Author chain BJ； PDBConstruct 1–163； UniProt 1–163 Author chain BK； PDBConstruct 1–163； UniProt 1–163 Author chain BL； PDBConstruct 1–163； UniProt 1–163 Author chain BM； PDBConstruct 1–163； UniProt 1–163 Author chain BN； PDBConstruct 1–163； UniProt 1–163 Author chain BO； PDBConstruct 1–163； UniProt 1–163 Author chain BP； PDBConstruct 1–163； UniProt 1–163 Author chain BQ； PDBConstruct 1–163； UniProt 1–163 Author chain BR； PDBConstruct 1–163； UniProt 1–163 Author chain BS； PDBConstruct 1–163； UniProt 1–163 Author chain BT； PDBConstruct 1–163； UniProt 1–163 Author chain BU； PDBConstruct 1–163； UniProt 1–163 Author chain BV； PDBConstruct 1–163； UniProt 1–163 Author chain BW； PDBConstruct 1–163； UniProt 1–163 Author chain BX； PDBConstruct 1–163； UniProt 1–163 Author chain BY； PDBConstruct 1–163； UniProt 1–163 Author chain BZ； PDBConstruct 1–163； UniProt 1–163 Author chain Ba； PDBConstruct 1–163； UniProt 1–163 Author chain Bb； PDBConstruct 1–163； UniProt 1–163 Author chain Bc； PDBConstruct 1–163； UniProt 1–163 Author chain Bd； PDBConstruct 1–163； UniProt 1–163 Author chain Be； PDBConstruct 1–163； UniProt 1–163 Author chain Bf； PDBConstruct 1–163； UniProt 1–163 Author chain Bg； PDBConstruct 1–163； UniProt 1–163 Author chain Bh； PDBConstruct 1–163； UniProt 1–163 Author chain Bi； PDBConstruct 1–163； UniProt 1–163 Author chain Bj； PDBConstruct 1–163； UniProt 1–163 Author chain Bk； PDBConstruct 1–163； UniProt 1–163 Author chain Bl； PDBConstruct 1–163； UniProt 1–163 Author chain Bm； PDBConstruct 1–163； UniProt 1–163 Author chain Bn； PDBConstruct 1–163； UniProt 1–163 Author chain Bo； PDBConstruct 1–163； UniProt 1–163 Author chain Bp； PDBConstruct 1–163； UniProt 1–163 Author chain Bq； PDBConstruct 1–163； UniProt 1–163 Author chain Br； PDBConstruct 1–163； UniProt 1–163 Author chain Bs； PDBConstruct 1–163； UniProt 1–163 Author chain Bt； PDBConstruct 1–163； UniProt 1–163 Author chain Bu； PDBConstruct 1–163； UniProt 1–163 Author chain Bv； PDBConstruct 1–163； UniProt 1–163 Author chain Bw； PDBConstruct 1–163； UniProt 1–163 Author chain Bx； PDBConstruct 1–163； UniProt 1–163 Author chain By； PDBConstruct 1–163； UniProt 1–163 Author chain Bz； PDBConstruct 1–163； UniProt 1–163

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4v96
Deposition date deposition_date	2012-02-01
Structure title title	The structure of a 1.8 MDa viral genome injection device suggests alternative infection mechanisms
Keywords keywords	Distal tail protein, Receptor-binding protein, Phage baseplate, host adsorption apparatus, genome injection device, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4v96__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4v96__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4v96__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	101.10 Å
Total Rg	101.30 Å
Atom count	118740
Residues	15597
Excluded volume	2104600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4v96__assembly_1__model_1`	78-meric （78）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ORF48
Molecular weight formula_weight	33876.1 kDa
Source method src_method	man
Copy count entity_count	18

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AB,AC,AD,AE,AF,AG,AH,AI,AJ,AK,AL,AM,AN,AO,AP,AQ,AR
Atom count atom_count	118740

MTEHFITLSTTEPNNNIGIVKLRHADVNSQAIVAQIVENGQPKNFEGLQPFFCLMAQEATGQGVSEESVVSFDAKNGTLKYVASDNALQFVGRNEAYFSFRKQEGGRWIEQFSTRTFHYIVEKSIYSQPFKDSNYWWTFKELYRIFNKYIEDGKKSWEQFVEANREILESIDPGGVLLAKVIDIEKIVNEKVPAGFKFVLEHDSEYQPEVKVTSYKNAIGTETDGFDSGPVFGGGTIYNVPVSLSYDRQKVYVEMPKSYTLAGDIILIDDGTLLVIKETQVLCFKMSDAKITKGYVFVA

Source Source

Source organism organism	Lactococcus phage TP901-1
NCBI taxonomy ID ncbi_taxonomy_id	35345
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ORF46
Molecular weight formula_weight	29085.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,AT,AU,AV,AW,AX

GYKFRDTTKQKHYRNLPFIPTSAMSYDGAWLEELIEGYQTLAVEGREMYSLSFETQDMQVGGVITNVKYPPRELTIKYKLEDRDPRVLQEKFDTLKAFLIRQEDVPIIFNDDLEYTFYGRFKTADNVAGDTNSIISSFTVLCSDPFKHGKIQSVKNKVIEVLPYPVKPDKLSFKLLTEGLLATDGNYRLKSSQAKKGDFLEFDFQTGDTFLNGKVNNNLLDLDSDFKNIRLTTGTDFSSSNYELTIQYRKAVL

Source Source

Source organism organism	Lactococcus phage TP901-1
NCBI taxonomy ID ncbi_taxonomy_id	35345
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	BPP
Molecular weight formula_weight	18365.5 kDa
Source method src_method	man
Copy count entity_count	54

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;BA,BB,BC,BD,BE,BF,BG,BH,BI,BJ,BK,BL,BM,BN,BO,BP,BQ,BR,BS,BT,BU,BV,BW,BX,BY,BZ,Ba,Bb,Bc,Bd,Be,Bf,Bg,Bh,Bi,Bj,Bk,Bl,Bm,Bn,Bo,Bp,Bq,Br,Bs,Bt,Bu,Bv,Bw,Bx,By,Bz,B1,B2 ;

MASIKKVYRGMKNGAETINDDLEAINSELTSGGNVVHKTGDETIAGKKTFTGNVEVNGSLTLPTKSWSGELGGGIILSLRKKGTTVEYSIGGEISSSILANSNLVNRSVPNEFCPRNRCSLVGHMVGGWNAFHIDIPSSGVCQWFGPTASSGTPRGTGTYPIDSAWSHPQFEK

Source Source

Source organism organism	Lactococcus phage TP901-1
NCBI taxonomy ID ncbi_taxonomy_id	35345
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	163.530 Å
Unit-cell length b length_b	287.360 Å
Unit-cell length c length_c	323.140 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	101.73 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	108

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	35.970 Å
R factor r_factor	0.2370
R_work r_work	0.2369
R_free r_free	0.2641

The structure of a 1.8 MDa viral genome injection device suggests alternative infection mechanisms

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF48

State in the Current Structure

Other States of the Same Protein in the Database

ORF46

State in the Current Structure

Other States of the Same Protein in the Database

BPP

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v96__assembly_1__model_1

4v96__assembly_1__model_1 | I(q)

4v96__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

The structure of a 1.8 MDa viral genome injection device suggests alternative infection mechanisms

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF48

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF46

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

BPP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4v96__assembly_1__model_1

4v96__assembly_1__model_1 | I(q)

4v96__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)