3unb

Mouse constitutive 20S proteasome in complex with PR-957

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234 Author chain O； PDBConstruct 1–234； UniProt 1–234 Author chain c； PDBConstruct 1–234； UniProt 1–234 Author chain q； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-4

OrganismNot specified

UniProt Q9R1P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–261； UniProt 1–261 Author chain P； PDBConstruct 1–261； UniProt 1–261 Author chain d； PDBConstruct 1–261； UniProt 1–261 Author chain r； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit alpha type-7

OrganismNot specified

UniProt Q9Z2U0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–248； UniProt 1–248 Author chain Q； PDBConstruct 1–248； UniProt 1–248 Author chain e； PDBConstruct 1–248； UniProt 1–248 Author chain s； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-5

OrganismNot specified

UniProt Q9Z2U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 1–241 Author chain R； PDBConstruct 1–241； UniProt 1–241 Author chain f； PDBConstruct 1–241； UniProt 1–241 Author chain t； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-1

OrganismNot specified

UniProt Q9R1P4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–263； UniProt 1–263 Author chain S； PDBConstruct 1–263； UniProt 1–263 Author chain g； PDBConstruct 1–263； UniProt 1–263 Author chain u； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-3

OrganismNot specified

UniProt O70435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–255； UniProt 1–255 Author chain T； PDBConstruct 1–255； UniProt 1–255 Author chain h； PDBConstruct 1–255； UniProt 1–255 Author chain v； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit alpha type-6

OrganismNot specified

UniProt Q9QUM9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–246； UniProt 1–246 Author chain U； PDBConstruct 1–246； UniProt 1–246 Author chain i； PDBConstruct 1–246； UniProt 1–246 Author chain w； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit beta type-7

OrganismNot specified

UniProt P70195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–234； UniProt 44–277 Author chain V； PDBConstruct 1–234； UniProt 44–277 Author chain j； PDBConstruct 1–234； UniProt 44–277 Author chain x； PDBConstruct 1–234； UniProt 44–277

Proteasome subunit beta type-3

OrganismNot specified

UniProt Q9R1P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–205； UniProt 1–205 Author chain W； PDBConstruct 1–205； UniProt 1–205 Author chain k； PDBConstruct 1–205； UniProt 1–205 Author chain y； PDBConstruct 1–205； UniProt 1–205

Proteasome subunit beta type-2

OrganismNot specified

UniProt Q9R1P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–201； UniProt 1–201 Author chain X； PDBConstruct 1–201； UniProt 1–201 Author chain l； PDBConstruct 1–201； UniProt 1–201 Author chain z； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-5

OrganismNot specified

UniProt O55234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 1； PDBConstruct 1–205； UniProt 60–264 Author chain K； PDBConstruct 1–205； UniProt 60–264 Author chain Y； PDBConstruct 1–205； UniProt 60–264 Author chain m； PDBConstruct 1–205； UniProt 60–264

Proteasome subunit beta type-1

OrganismNot specified

UniProt O09061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 2； PDBConstruct 1–213； UniProt 28–240 Author chain L； PDBConstruct 1–213； UniProt 28–240 Author chain Z； PDBConstruct 1–213； UniProt 28–240 Author chain n； PDBConstruct 1–213； UniProt 28–240

Proteasome subunit beta type-4

OrganismNot specified

UniProt P99026

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-6 × 2 （Q60692） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 3； PDBConstruct 1–219； UniProt 46–264 Author chain M； PDBConstruct 1–219； UniProt 46–264 Author chain a； PDBConstruct 1–219； UniProt 46–264 Author chain o； PDBConstruct 1–219； UniProt 46–264

Proteasome subunit beta type-6

OrganismNot specified

UniProt Q60692

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-4 × 2 （P99026） 1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol × 6 water × 28	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 4； PDBConstruct 1–205； UniProt 34–238 Author chain N； PDBConstruct 1–205； UniProt 34–238 Author chain b； PDBConstruct 1–205； UniProt 34–238 Author chain p； PDBConstruct 1–205； UniProt 34–238

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3unb
Deposition date deposition_date	2011-11-15
Structure title title	Mouse constitutive 20S proteasome in complex with PR-957
Keywords keywords	;20S proteasome comprises 28 subunits; each subunit adopts the fold of an antiparallel beta-sheet flanked by helices, Protease, Regulatory complexes, Covalent binding of PR-957 to all active sites, HYDROLASE-HYDROLASE INHIBITOR complex ;; HYDROLASE/HYDROLASE INHIBITOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3unb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3unb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3unb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.23 Å
Rg (electron density)	59.88 Å
Total Rg	60.12 Å
Atom count	48878
Residues	6256
Excluded volume	870980 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3unb__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3unb__assembly_2__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25955.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,O,c,q
Atom count atom_count	99236

MAKRGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29512.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,P,d,r

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQREKDK

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27839.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,Q,e,s

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVAKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26436.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,R,f,t

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 5 Entity 5 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29586.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,S,g,u

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAAEEPAEKADEPMEH

Entity 6 Entity 6 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28442.2 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,T,h,v

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Entity 7 Entity 7 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27405.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,U,i,w

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 8 Entity 8 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	25280.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,V,j,x

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS

Entity 9 Entity 9 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22988.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,W,k,y

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDKITTRTLKARMD

Entity 10 Entity 10 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22935.4 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,X,l,z

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS

Entity 11 Entity 11 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	22554.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,Y,m,1

TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	23577.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Z,n,2

RFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	24384.7 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,a,o,3

TQNPMVTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGFE

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	22014.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,b,p,4

TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP

Entity 15 Entity 15 non-polymer

Description description	1,2,4-trideoxy-4-methyl-2-{[N-(morpholin-4-ylacetyl)-L-alanyl-O-methyl-L-tyrosyl]amino}-1-phenyl-D-xylitol
Molecular weight formula_weight	584.7 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 16 Entity 16 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1480

▼

6. Fold Classification (SCOP + CATH) 86 domains

SCOP 2.08 (30 domains)

Domain ID domain_id	d3unb1_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unb2_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unb3_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unb4_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unba_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbe_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d3unbf_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbg_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbi_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbj_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbk_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbl_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbm_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbo_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbq_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbr_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbs_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.0 — automated matches

Domain ID domain_id	d3unbt_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbu_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbv_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbw_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbx_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unby_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

Domain ID domain_id	d3unbz_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.153 — Ntn hydrolase-like
Superfamily Superfamily superfamily	d.153.1 — N-terminal nucleophile aminohydrolases (Ntn hydrolases)
Family Family family	d.153.1.4 — Proteasome subunits

CATH v4.4 (56 domains)

Domain ID domain_id	3unb100
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unb200
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unb300
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unb400
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbA00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbB00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbC00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbD00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbE00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbF00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbG00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbH00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbI00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbJ00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbK00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbL00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbM00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbN00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbO00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbP00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbQ00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbR00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbS00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbT00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbU00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbV00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbW00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbX00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbY00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbZ00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unba00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbb00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbc00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbd00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbe00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbf00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbg00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbh00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbi00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbj00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbk00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbl00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbm00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbn00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbo00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbp00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbq00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbr00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbs00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbt00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbu00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbv00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbw00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbx00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unby00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

Domain ID domain_id	3unbz00
Class class	3 — Alpha Beta
Architecture architecture	60 — 4-Layer Sandwich
Topology topology	20 — Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1
Homologous superfamily homologous superfamily	10 — Aminohydrolase, N-terminal nucleophile (Ntn) domain

▶

Unit-cell length a length_a	171.720 Å
Unit-cell length b length_b	198.590 Å
Unit-cell length c length_c	226.750 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	106.59 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.2318
R_work r_work	0.2297
R_free r_free	0.2726

Mouse constitutive 20S proteasome in complex with PR-957

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer