SAXSdb — 3vto

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein gp45

Enterobacteria phage Mu

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	FE (III) ION × 1 CALCIUM ION × 1 CHLORIDE ION × 1 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	FE (III) ION × 1 CALCIUM ION × 1 CHLORIDE ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VG45_BPMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–107； UniProt 92–197 Author chain B； PDBConstruct 2–107； UniProt 92–197 Author chain C； PDBConstruct 2–107； UniProt 92–197 Author chain P； PDBConstruct 2–107； UniProt 92–197 Author chain Q； PDBConstruct 2–107； UniProt 92–197 Author chain R； PDBConstruct 2–107； UniProt 92–197

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3vto
Deposition date deposition_date	2012-06-01
Structure title title	The crystal structure of the C-terminal domain of Mu phage central spike
Keywords keywords	beta-helix, central spike, Mu phage, METAL BINDING PROTEIN; METAL BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3vto__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3vto__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3vto__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.74 Å
Rg (electron density)	24.09 Å
Total Rg	24.57 Å
Atom count	2389
Residues	314
Excluded volume	41820 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3vto__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3vto__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Protein gp45
Molecular weight formula_weight	12848.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,P,Q,R
Atom count atom_count	5490

MRRYRPTNLEPGDAGIYHHEGHRIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAPDAIINGKSTDKHIHRGDSGGTTGPMQLEHHHHHH

Source Source

Source organism organism	Enterobacteria phage Mu
NCBI taxonomy ID ncbi_taxonomy_id	10677
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	578

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	3vtoQ02
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	170 — heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 2
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	40.403 Å
Unit-cell length b length_b	152.399 Å
Unit-cell length c length_c	53.062 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.01 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.440 Å
Low-resolution limit resolution_low	19.520 Å
R factor r_factor	0.1639
R_work r_work	0.1623
R_free r_free	0.1946

The crystal structure of the C-terminal domain of Mu phage central spike

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein gp45

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3vto__assembly_2__model_1

3vto__assembly_2__model_1 | I(q)

3vto__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

The crystal structure of the C-terminal domain of Mu phage central spike

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein gp45

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3vto__assembly_2__model_1

3vto__assembly_2__model_1 | I(q)

3vto__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)