SAXSdb — 3znv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN FAM105B

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 80–352	Fragment：OTU DOMAIN, RESIDUES 80-352	GOL GLYCEROL × 4 CA CALCIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 6.5；100 MM MES/IMIDAZOLE PH 6.5, 30 MM MGCL2, 30 MM CACL2, 10% PEG 4000, 20% GLYCEROL	Resolution 1.30 Å R-free 0.154

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3ZNV	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3ZNX Crystal structure of the OTU domain of OTULIN D336A mutant Deposited 2013-02-18	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 80–352（273 aa） Fragment：OTU DOMAIN, RESIDUES 80-352	Mutation：YES	CA CALCIUM ION × 1 CL CHLORIDE ION × 1 GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；100 MM MES/IMIDAZOLE PH 6.5, 30 MM MGCL2, 30 MM CACL2, 10% PEG 4,000, 20% GLYCEROL	Resolution 1.35 Å R-free 0.159
3ZNZ Crystal structure of OTULIN OTU domain (C129A) in complex with Met1- di ubiquitin Deposited 2013-02-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 80–352（273 aa） Fragment：OTU DOMAIN, RESIDUES 80-352	Mutation：YES	SO4 SULFATE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；100 MM BIS-TRIS, 2M (NH4)2SO4, PH 6.5	Resolution 1.90 Å R-free 0.222
4KSJ Crystal structure of the OTU domain of Gumby/Fam105B at 1.6 angstrom Deposited 2013-05-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Non-standard monomer：Yes (specific site not provided by mmCIF)	BME BETA-MERCAPTOETHANOL × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；100mM MES, 200mM MgCl2, 19% PEG3350, pH 6.0, VAPOR DIFFUSION, HANGING DROP	Resolution 1.60 Å R-free 0.215
4KSK Gumby/Fam105B in complex with ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 55–352（298 aa） Fragment：OTU domain (unp residues 55-352)	Mutation：C129S	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM Bis Tris, 200 mM AmSO4, 20% PEG3350, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.268
4KSK Gumby/Fam105B in complex with ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 55–352（298 aa） Fragment：OTU domain (unp residues 55-352)	Mutation：C129S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；298 K；100 mM Bis Tris, 200 mM AmSO4, 20% PEG3350, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.268
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain S 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain U 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain W 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4KSL Gumby/Fam105B in complex with linear di-ubiquitin Deposited 2013-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain Q 79–352（274 aa） Fragment：OTU domain (unp residues 79-352)	Mutation：C129A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；298 K；100mM acetate, 100mM CaCl2, 100 mM glycine, 2.5M sodium formate, 24% PEG3350 , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.83 Å R-free 0.254
4OYK Structure of HOIP PUB domain bound to OTULIN PIM Deposited 2014-02-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 49–67（19 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；295 K；32% PEG 6000, 1M LiCl, 100 mM Tris pH 8.4	Resolution 2.00 Å R-free 0.237
4OYK Structure of HOIP PUB domain bound to OTULIN PIM Deposited 2014-02-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 49–67（19 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；295 K；32% PEG 6000, 1M LiCl, 100 mM Tris pH 8.4	Resolution 2.00 Å R-free 0.237
4P0B Crystal structure of HOIP PUB domain in complex with OTULIN PIM Deposited 2014-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 52–61（10 aa） Fragment：UNP Residues 52-61	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0,1M Tris, 20% 2-methyl-2,4-pentanediol, 15% Polyethyleneglycol 3350, pH 7.5	Resolution 2.70 Å R-free 0.270
4P0B Crystal structure of HOIP PUB domain in complex with OTULIN PIM Deposited 2014-02-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 52–61（10 aa） Fragment：UNP Residues 52-61	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0,1M Tris, 20% 2-methyl-2,4-pentanediol, 15% Polyethyleneglycol 3350, pH 7.5	Resolution 2.70 Å R-free 0.270
5OE7 Structure of OTULIN bound to the Met1-linked diubiquitin activity probe Deposited 2017-07-07	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 80–350（271 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；298 K；1.9-2.1 M Ammonium sulphate, 100 mM bis-tris	Resolution 2.95 Å R-free 0.309
6I9C Structure of the OTU domain of OTULIN G281R mutant Deposited 2018-11-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 80–345（266 aa）	Mutation：G281R	GOL GLYCEROL × 4 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；277 K；100 mM HEPES pH 7.4, 18 % (w/v) PEG 6,000, 1M LiCl	Resolution 1.77 Å R-free 0.179
6SAK Structure of the OTULINcat C129A - SNX27 PDZ domain complex. Deposited 2019-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 80–352（273 aa）	Mutation：C129A	GOL GLYCEROL × 5 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；291 K；19% (w/v) PEG 3,350, 200 mM Li2(SO4), 100 mM Bis-Tris pH 6.8	Resolution 2.00 Å R-free 0.253
6SAK Structure of the OTULINcat C129A - SNX27 PDZ domain complex. Deposited 2019-07-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 80–352（273 aa）	Mutation：C129A	GOL GLYCEROL × 4 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；291 K；19% (w/v) PEG 3,350, 200 mM Li2(SO4), 100 mM Bis-Tris pH 6.8	Resolution 2.00 Å R-free 0.253
9LZX Crystal structure of the OTU domain of OTULIN in complex with 11B6 Deposited 2025-02-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 80–345（266 aa）	Not recorded	A1EMF 3-phenyl-5-prop-2-enylsulfanyl-4~{H}-1,2,4-triazole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG 3350,MES,magnesium chloride	Resolution 2.00 Å R-free 0.251

11 other PDB entries and 26 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	F105B_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–275； UniProt 80–352

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3znv
Deposition date deposition_date	2013-02-18
Structure title title	Crystal structure of the OTU domain of OTULIN at 1.3 Angstroms.
Keywords keywords	HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.05 Å
Radius of gyration Rg (electron density) rg_electron	18.82 Å
Forward intensity I(0) i0	16517800.00
Molecular weight molecular_weight	31234.0 kDa
Excluded volume excluded_volume	39338 Å³
Envelope volume envelope_volume	44926 Å³
Hydration-shell volume shell_volume	19923 Å³
Envelope diameter envelope_diameter	65.9 Å
Shell Rg shell_rg	25.24 Å
Envelope Rg envelope_rg	19.14 Å
Shape Rg shape_rg	18.77 Å
Total Rg total_rg	19.90 Å
Total atoms total_atoms	2194
Residues n_residues	269
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	64.1 Å
Rg (real space) rg_real	19.98 Å
Rg uncertainty (real space) rg_real_error	0.30 Å
I(0) (real space) i0_real	1.6520e+07
I(0) uncertainty (real space) i0_real_error	2.0650e+05
Rg (reciprocal space) rg_reciprocal	19.99 Å
I(0) (reciprocal space) i0_reciprocal	16520000.0000
Solution quality estimate total_estimate	0.8943
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	25.6 Å
Skewness Skewness skewness	0.242
Kurtosis Kurtosis kurtosis	-0.319
Angular range angular_range	— – 0.3950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3025000.0000
Real-space data points n_real_points	71
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.878; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.993

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	PROTEIN FAM105B
Molecular weight formula_weight	31926.7 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2702

GPLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLPEKLISKYNWIKQWKLGLKFDGKNEDLVDKIKESLTLLRKKWAGLAEMRTAEARQIACDELFTNEAEEYSLYEAVKFLMLNRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLEQVEMFLLAYAVRHTIQVYRLSKYNTEEFITVYPTDPPKDWPVVTLIAEDDRHYNIPVRVCEETSL

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	333

▶

8. Citations (1)

▶

Unit-cell length a length_a	43.490 Å
Unit-cell length b length_b	72.010 Å
Unit-cell length c length_c	94.670 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.300 Å
Low-resolution limit resolution_low	29.280 Å
R factor r_factor	0.1268
R_work r_work	0.1253
R_free r_free	0.1544

fit	/app/data/saxs_computation/zn/3znv/3znv.fit
pddf	/app/data/pr_computation/zn/3znv/3znv.pr.out
profile	/app/data/saxs_computation/zn/3znv/3znv.dat

Crystal structure of the OTU domain of OTULIN at 1.3 Angstroms.

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN FAM105B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction