SAXSdb — 3zp7

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHORISMATE MUTASE AROH

BACILLUS SUBTILIS

UniProt P19080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 3	PREPHENIC ACID × 2 (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid × 2 water × 3	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 3	PREPHENIC ACID × 3 (3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AROH_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–127； UniProt 1–127 Author chain B； PDBConstruct 1–127； UniProt 1–127 Author chain C； PDBConstruct 1–127； UniProt 1–127 Author chain D； PDBConstruct 1–127； UniProt 1–127 Author chain E； PDBConstruct 1–127； UniProt 1–127 Author chain F； PDBConstruct 1–127； UniProt 1–127

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3zp7
Deposition date deposition_date	2013-02-26
Structure title title	Arg90Cit chorismate mutase of Bacillus subtilis in complex with chorismate and prephenate
Keywords keywords	ISOMERASE, PSEUDO-ALPHA BETA-BARREL, NON-PROTEINOGENIC AMINO ACID, SEMI-SYNTHETIC, REACTION MECHANISM; ISOMERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3zp7__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3zp7__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3zp7__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.14 Å
Rg (electron density)	18.93 Å
Total Rg	19.81 Å
Atom count	2844
Residues	348
Excluded volume	51282 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3zp7__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`3zp7__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	CHORISMATE MUTASE AROH
Molecular weight formula_weight	14521.9 kDa
EC 编号 ec_number	5.4.99.5
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	6477

MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAKAVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQEQIRHVYLEKAVVLRPDLSLTKNTEL

Source Source

Source organism organism	BACILLUS SUBTILIS
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	PREPHENIC ACID
Molecular weight formula_weight	226.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	(3R,4R)-3-[(1-carboxyethenyl)oxy]-4-hydroxycyclohexa-1,5-diene-1-carboxylic acid
Molecular weight formula_weight	226.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	563

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d3zp7a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

Domain ID domain_id	d3zp7b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

Domain ID domain_id	d3zp7c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

Domain ID domain_id	d3zp7d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

Domain ID domain_id	d3zp7e_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

Domain ID domain_id	d3zp7f_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.1 — YjgF-like
Family Family family	d.79.1.2 — Chorismate mutase

CATH v4.4 (6 domains)

Domain ID domain_id	3zp7A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

Domain ID domain_id	3zp7B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

Domain ID domain_id	3zp7C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

Domain ID domain_id	3zp7D00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

Domain ID domain_id	3zp7E00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

Domain ID domain_id	3zp7F00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	40 — RutC-like

▶

Unit-cell length a length_a	50.245 Å
Unit-cell length b length_b	51.307 Å
Unit-cell length c length_c	70.138 Å
Unit-cell angle α angle_alpha	97.51 °
Unit-cell angle β angle_beta	92.91 °
Unit-cell angle γ angle_gamma	101.11 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.698 Å
Low-resolution limit resolution_low	37.964 Å
R factor r_factor	0.1677
R_work r_work	0.1650
R_free r_free	0.2185

Arg90Cit chorismate mutase of Bacillus subtilis in complex with chorismate and prephenate

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHORISMATE MUTASE AROH

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3zp7__assembly_2__model_1

3zp7__assembly_2__model_1 | I(q)

3zp7__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Arg90Cit chorismate mutase of Bacillus subtilis in complex with chorismate and prephenate

1. Protein Identity and Related Structures Protein Identity & Related Structures

CHORISMATE MUTASE AROH

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3zp7__assembly_2__model_1

3zp7__assembly_2__model_1 | I(q)

3zp7__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

7. Citations (1)