SAXSdb — 4aah

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

METHANOL DEHYDROGENASE

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	METHANOL DEHYDROGENASE × 2 （P38540） CALCIUM ION × 2 PYRROLOQUINOLINE QUINONE × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHM1_METME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–571； UniProt 3–573 Author chain C； PDBConstruct 1–571； UniProt 3–573

METHANOL DEHYDROGENASE

OrganismNot specified

UniProt P38540

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	METHANOL DEHYDROGENASE × 2 （P38539） CALCIUM ION × 2 PYRROLOQUINOLINE QUINONE × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DHM2_METME
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–69； UniProt 28–96 Author chain D； PDBConstruct 1–69； UniProt 28–96

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4aah
Deposition date deposition_date	1996-03-10
Structure title title	METHANOL DEHYDROGENASE FROM METHYLOPHILUS W3A1
Keywords keywords	OXIDOREDUCTASE (PQQ(A)-CHOH(D)); OXIDOREDUCTASE (PQQ(A)-CHOH(D))
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4aah__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4aah__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4aah__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.68 Å
Rg (electron density)	34.15 Å
Total Rg	34.66 Å
Atom count	9944
Residues	1280
Excluded volume	175810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4aah__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	METHANOL DEHYDROGENASE
Molecular weight formula_weight	62500.6 kDa
EC 编号 ec_number	1.1.99.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	10465

DADLDKQVNTAGAWPIATGGYYSQHNSPLAQINKSNVKNVKAAWSFSTGVLNGHEGAPLVIGDMMYVHSAFPNNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAGQIVKKQANGHLLALDAKTGKINWEVEVCDPKVGSTLTQAPFVAKDTVLMGCSGAELGVRGAVNAFDLKTGELKWRAFATGSDDSVRLAKDFNSANPHYGQFGLGTKTWEGDAWKIGGGTNWGWYAYDPKLNLFYYGSGNPAPWNETMRPGDNKWTMTIWGRDLDTGMAKWGYQKTPHDEWDFAGVNQMVLTDQPVNGKMTPLLSHIDRNGILYTLNRENGNLIVAEKVDPAVNVFKKVDLKTGTPVRDPEFATRMDHKGTNICPSAMGFHNQGVDSYDPESRTLYAGLNHICMDWEPFMLPYRAGQFFVGATLAMYPGPNGPTKKEMGQIRAFDLTTGKAKWTKWEKFAAWGGTLYTKGGLVWYATLDGYLKALDNKDGKELWNFKMPSGGIGSPMTYSFKGKQYIGSMYGVGGWPGVGLVFDLTDPSAGLGAVGAFRELQNHTQMGGGLMVFSL

Entity 2 Entity 2 polymer

Description description	METHANOL DEHYDROGENASE
Molecular weight formula_weight	7770.6 kDa
EC 编号 ec_number	1.1.99.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

YDGQNCKEPGNCWENKPGYPEKIAGSKYDPKHDPVELNKQEESIKAMDARNAKRIANAKSSGNFVFDVK

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	PYRROLOQUINOLINE QUINONE
Molecular weight formula_weight	330.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	521

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d4aaha_
Class class	b — All beta proteins
Fold Fold fold	b.70 — 8-bladed beta-propeller
Superfamily Superfamily superfamily	b.70.1 — Quinoprotein alcohol dehydrogenase-like
Family Family family	b.70.1.1 — Quinoprotein alcohol dehydrogenase-like

Domain ID domain_id	d4aahb_
Class class	a — All alpha proteins
Fold Fold fold	a.137 — Non-globular all-alpha subunits of globular proteins
Superfamily Superfamily superfamily	a.137.2 — Methanol dehydrogenase subunit
Family Family family	a.137.2.1 — Methanol dehydrogenase subunit

Domain ID domain_id	d4aahc_
Class class	b — All beta proteins
Fold Fold fold	b.70 — 8-bladed beta-propeller
Superfamily Superfamily superfamily	b.70.1 — Quinoprotein alcohol dehydrogenase-like
Family Family family	b.70.1.1 — Quinoprotein alcohol dehydrogenase-like

Domain ID domain_id	d4aahd_
Class class	a — All alpha proteins
Fold Fold fold	a.137 — Non-globular all-alpha subunits of globular proteins
Superfamily Superfamily superfamily	a.137.2 — Methanol dehydrogenase subunit
Family Family family	a.137.2.1 — Methanol dehydrogenase subunit

CATH v4.4 (4 domains)

Domain ID domain_id	4aahA00
Class class	2 — Mainly Beta
Architecture architecture	140 — 8 Propeller
Topology topology	10 — Methanol Dehydrogenase; Chain A
Homologous superfamily homologous superfamily	10 — Quinoprotein alcohol dehydrogenase-like superfamily

Domain ID domain_id	4aahB00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	160 — Methanol Dehydrogenase; Chain B
Homologous superfamily homologous superfamily	10 — Methanol dehydrogenase, beta subunit

Domain ID domain_id	4aahC00
Class class	2 — Mainly Beta
Architecture architecture	140 — 8 Propeller
Topology topology	10 — Methanol Dehydrogenase; Chain A
Homologous superfamily homologous superfamily	10 — Quinoprotein alcohol dehydrogenase-like superfamily

Domain ID domain_id	4aahD00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	160 — Methanol Dehydrogenase; Chain B
Homologous superfamily homologous superfamily	10 — Methanol dehydrogenase, beta subunit

▶

Unit-cell length a length_a	124.900 Å
Unit-cell length b length_b	62.700 Å
Unit-cell length c length_c	85.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.40 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.1520
R_work r_work	—
R_free r_free	—

METHANOL DEHYDROGENASE FROM METHYLOPHILUS W3A1

1. Protein Identity and Related Structures Protein Identity & Related Structures

METHANOL DEHYDROGENASE

State in the Current Structure

Other States of the Same Protein in the Database

METHANOL DEHYDROGENASE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4aah__assembly_1__model_1

4aah__assembly_1__model_1 | I(q)

4aah__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)

METHANOL DEHYDROGENASE FROM METHYLOPHILUS W3A1

1. Protein Identity and Related Structures Protein Identity & Related Structures

METHANOL DEHYDROGENASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

METHANOL DEHYDROGENASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4aah__assembly_1__model_1

4aah__assembly_1__model_1 | I(q)

4aah__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (3)