4dx9

ICAP1 in complex with integrin beta 1 cytoplasmic tail

Method: X-RAY DIFFRACTION D_max: 204.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrin beta-1-binding protein 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
10	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain S； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
11	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain U； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
12	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain W； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
13	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Y； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
14	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain a； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
15	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain c； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
16	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain e； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
17	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain g； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
18	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain i； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
19	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain k； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
20	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain m； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
21	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain o； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
22	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 2； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
23	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain s； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
24	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain u； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
25	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 1； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
26	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain y； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
27	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 3； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
28	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 5； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
29	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 0； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
30	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 4； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
31	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain q； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
32	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain w； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	No other associated polymer	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
7	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain M； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
8	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain O； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
9	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Q； UniProt 49–200	Fragment：PTB domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Integrin beta-1 × 1 （P05556）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4DX9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4DX8 ICAP1 in complex with KRIT1 N-terminus Deposited 2012-02-27	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 49–200（152 aa） Fragment：PTB domain	Not recorded	BR BROMIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.06M AmSO4, 0.2M Ammonium formate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.54 Å R-free 0.252
4DX8 ICAP1 in complex with KRIT1 N-terminus Deposited 2012-02-27	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 49–200（152 aa） Fragment：PTB domain	Not recorded	BR BROMIDE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.06M AmSO4, 0.2M Ammonium formate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.54 Å R-free 0.252
4DX8 ICAP1 in complex with KRIT1 N-terminus Deposited 2012-02-27	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 49–200（152 aa） Fragment：PTB domain	Not recorded	BR BROMIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.06M AmSO4, 0.2M Ammonium formate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.54 Å R-free 0.252
4DX8 ICAP1 in complex with KRIT1 N-terminus Deposited 2012-02-27	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 49–200（152 aa） Fragment：PTB domain	Not recorded	BR BROMIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.06M AmSO4, 0.2M Ammonium formate, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.54 Å R-free 0.252
4JIF Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide Deposited 2013-03-05	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 49–200（152 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；18-20%PEG3350, 0.2M MgCl2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.226
4JIF Co-crystal structure of ICAP1 PTB domain in complex with a KRIT1 peptide Deposited 2013-03-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 49–200（152 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；18-20%PEG3350, 0.2M MgCl2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.70 Å R-free 0.226

2 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ITBP1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 6–157； UniProt 49–200 Author chain 1； PDBConstruct 6–157； UniProt 49–200 Author chain 2； PDBConstruct 6–157； UniProt 49–200 Author chain 3； PDBConstruct 6–157； UniProt 49–200 Author chain 4； PDBConstruct 6–157； UniProt 49–200 Author chain 5； PDBConstruct 6–157； UniProt 49–200 Author chain A； PDBConstruct 6–157； UniProt 49–200 Author chain C； PDBConstruct 6–157； UniProt 49–200 Author chain E； PDBConstruct 6–157； UniProt 49–200 Author chain G； PDBConstruct 6–157； UniProt 49–200 Author chain I； PDBConstruct 6–157； UniProt 49–200 Author chain K； PDBConstruct 6–157； UniProt 49–200 Author chain M； PDBConstruct 6–157； UniProt 49–200 Author chain O； PDBConstruct 6–157； UniProt 49–200 Author chain Q； PDBConstruct 6–157； UniProt 49–200 Author chain S； PDBConstruct 6–157； UniProt 49–200 Author chain U； PDBConstruct 6–157； UniProt 49–200 Author chain W； PDBConstruct 6–157； UniProt 49–200 Author chain Y； PDBConstruct 6–157； UniProt 49–200 Author chain a； PDBConstruct 6–157； UniProt 49–200 Author chain c； PDBConstruct 6–157； UniProt 49–200 Author chain e； PDBConstruct 6–157； UniProt 49–200 Author chain g； PDBConstruct 6–157； UniProt 49–200 Author chain i； PDBConstruct 6–157； UniProt 49–200 Author chain k； PDBConstruct 6–157； UniProt 49–200 Author chain m； PDBConstruct 6–157； UniProt 49–200 Author chain o； PDBConstruct 6–157； UniProt 49–200 Author chain q； PDBConstruct 6–157； UniProt 49–200 Author chain s； PDBConstruct 6–157； UniProt 49–200 Author chain u； PDBConstruct 6–157； UniProt 49–200 Author chain w； PDBConstruct 6–157； UniProt 49–200 Author chain y； PDBConstruct 6–157； UniProt 49–200

Integrin beta-1

OrganismNot specified

UniProt P05556

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
10	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain T； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
11	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain V； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
12	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain X； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
13	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Z； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
14	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain b； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
15	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain d； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
16	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain f； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
17	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain h； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
18	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain j； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
19	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain l； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
20	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain n； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
21	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain p； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
22	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain r； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
23	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain t； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
24	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain v； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
25	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain x； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
26	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain z； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
27	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 8； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
28	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 6； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
29	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 9； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
30	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain 7； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
7	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain N； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
8	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain P； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312
9	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain R； UniProt 784–798	Fragment：Cytoplasmic tail	Integrin beta-1-binding protein 1 × 1 （O14713）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；1.2M sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.99 Å R-free 0.312

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4DX9	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3G9W Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail Deposited 2009-02-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 752–801（50 aa） Fragment：Cytoplasmic Tail	Not recorded	GOL GLYCEROL × 2 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；0.1M ammonium acetate, 0.02M magnesium chloride, 0.05M HEPES, 5% PEG 8k, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.17 Å R-free 0.248
3G9W Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail Deposited 2009-02-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 752–801（50 aa） Fragment：Cytoplasmic Tail	Not recorded	GOL GLYCEROL × 4 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；277 K；0.1M ammonium acetate, 0.02M magnesium chloride, 0.05M HEPES, 5% PEG 8k, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.17 Å R-free 0.248
3T9K Crystal Structure of ACAP1 C-portion mutant S554D fused with integrin beta1 peptide Deposited 2011-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 758–769（12 aa）	Mutation：S554D	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；289 K；0.2M ammonium sulfate, 14% PEG 3350, 0.1M Sodium Citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.30 Å R-free 0.225
3T9K Crystal Structure of ACAP1 C-portion mutant S554D fused with integrin beta1 peptide Deposited 2011-08-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 758–769（12 aa）	Mutation：S554D	ZN ZINC ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；289 K；0.2M ammonium sulfate, 14% PEG 3350, 0.1M Sodium Citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.30 Å R-free 0.225
3VI3 Crystal structure of alpha5beta1 integrin headpiece (ligand-free form) Deposited 2011-09-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M Bis-tris (pH6.5), 20%(w/v) PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.267
3VI3 Crystal structure of alpha5beta1 integrin headpiece (ligand-free form) Deposited 2011-09-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M Bis-tris (pH6.5), 20%(w/v) PEG8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.267
3VI4 Crystal structure of alpha5beta1 integrin headpiece in complex with RGD peptide Deposited 2011-09-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 21–465（445 aa）	Not recorded	CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M Bis-tris (pH6.5), 20%(w/v) PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.275
3VI4 Crystal structure of alpha5beta1 integrin headpiece in complex with RGD peptide Deposited 2011-09-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain D 21–465（445 aa）	Not recorded	CA CALCIUM ION × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；0.1M Bis-tris (pH6.5), 20%(w/v) PEG 8000, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.275
4WJK Metal Ion and Ligand Binding of Integrin Deposited 2014-09-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 MG MAGNESIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1 M HEPES 7.2, 16% PEG 6000	Resolution 1.85 Å R-free 0.238
4WK0 Metal Ion and Ligand Binding of Integrin Deposited 2014-10-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1 M HEPES 7.2, 16% PEG 6000	Resolution 1.78 Å R-free 0.223
4WK2 Metal Ion and Ligand Binding of Integrin Deposited 2014-10-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1 M HEPES 7.2, 16% PEG 6000	Resolution 2.50 Å R-free 0.254
4WK4 Metal Ion and Ligand Binding of Integrin Deposited 2014-10-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 21–465（445 aa） Fragment：UNP residues 21-465	Not recorded	CA CALCIUM ION × 6 MG MAGNESIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；293 K；0.1 M HEPES 7.2, 16% PEG 6000	Resolution 2.50 Å R-free 0.236
7CEB Crystal structure of alpha6beta1 integrin headpiece Deposited 2020-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 21–465（445 aa）	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；23% PEG1000, 0.2 M NaCl, 0.1 M Na/K phosphate, pH 6.5	Resolution 2.89 Å R-free 0.249
7CEC Structure of alpha6beta1 integrin in complex with laminin-511 Deposited 2020-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 21–465（445 aa）	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MN MANGANESE (II) ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
7NWL Cryo-EM structure of human integrin alpha5beta1 (open form) in complex with fibronectin and TS2/16 Fv-clasp Deposited 2021-03-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 21–798（778 aa）	Not recorded	MN MANGANESE (II) ION × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.10 Å
7NXD Cryo-EM structure of human integrin alpha5beta1 in the half-bent conformation Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 21–798（778 aa）	Not recorded	CA CALCIUM ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.60 Å
8RPQ Solution NMR structure of Integrin beta-1 TMD Deposited 2024-01-16	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 726–761（36 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；300 K；Ionic strength (raw mmCIF value) 0；Pressure 1 NMR sample composition 0.5 uM NA Itgb1, trifluoroethanol/water \| trifluoroethanol/water	Resolution not provided
8W30 Crystal structure of alpha-V beta-1 integrin headpiece in complex with TR01225179 Deposited 2024-02-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 21–465（445 aa）	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 A1AFA N-(2,4-dichlorobenzoyl)-L-phenylalanine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；28% pentaerythritol ethoxylate (15/4_EO/OH), 0.05M ammonium sulfate, 0.05M Bis Tris pH 6.5	Resolution 2.45 Å R-free 0.275
9B9J Integrin alpha-5 beta-1 in complex with BIIG2 Fab Deposited 2024-04-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–728（728 aa）	Not recorded	CA CALCIUM ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；20mM Tris-HCL, 150mM NaCl, 5mM CaCl2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9B9K Integrin alpha-5 beta-1 in complex with MINT1526A Fab Deposited 2024-04-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–728（728 aa）	Not recorded	CA CALCIUM ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
9CKV Cryo-EM structure of alpha5beta1 integrin in complex with NeoNectin Deposited 2024-07-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–728（728 aa）	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 MN MANGANESE (II) ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9DIA Cryo-EM structure of alpha5beta1 integrin in complex with NeoNectin candidate 2 Deposited 2024-09-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–728（728 aa）	Not recorded	CA CALCIUM ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 MN MANGANESE (II) ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
9EF2 Cryo-EM structure of alpha5beta1 integrin in complex with NeoNectin candidate 2, open conformation Deposited 2024-11-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–728（728 aa）	Not recorded	CA CALCIUM ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 MN MANGANESE (II) ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.36 Å
9NAB Cryo-EM structure of the alpha5beta1 integrin headpiece with OS2966 Fab Deposited 2025-02-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 21–465（445 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.54 Å
9P6S Cryo-EM structure of human integrin alpha5beta1 in complex with fibronectin (FN 7-10) Deposited 2025-06-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 26–465（440 aa）	Not recorded	MN MANGANESE (II) ION × 7 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 2.61 Å

21 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ITB1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 6； PDBConstruct 1–15； UniProt 784–798 Author chain 7； PDBConstruct 1–15； UniProt 784–798 Author chain 8； PDBConstruct 1–15； UniProt 784–798 Author chain 9； PDBConstruct 1–15； UniProt 784–798 Author chain B； PDBConstruct 1–15； UniProt 784–798 Author chain D； PDBConstruct 1–15； UniProt 784–798 Author chain F； PDBConstruct 1–15； UniProt 784–798 Author chain H； PDBConstruct 1–15； UniProt 784–798 Author chain J； PDBConstruct 1–15； UniProt 784–798 Author chain L； PDBConstruct 1–15； UniProt 784–798 Author chain N； PDBConstruct 1–15； UniProt 784–798 Author chain P； PDBConstruct 1–15； UniProt 784–798 Author chain R； PDBConstruct 1–15； UniProt 784–798 Author chain T； PDBConstruct 1–15； UniProt 784–798 Author chain V； PDBConstruct 1–15； UniProt 784–798 Author chain X； PDBConstruct 1–15； UniProt 784–798 Author chain Z； PDBConstruct 1–15； UniProt 784–798 Author chain b； PDBConstruct 1–15； UniProt 784–798 Author chain d； PDBConstruct 1–15； UniProt 784–798 Author chain f； PDBConstruct 1–15； UniProt 784–798 Author chain h； PDBConstruct 1–15； UniProt 784–798 Author chain j； PDBConstruct 1–15； UniProt 784–798 Author chain l； PDBConstruct 1–15； UniProt 784–798 Author chain n； PDBConstruct 1–15； UniProt 784–798 Author chain p； PDBConstruct 1–15； UniProt 784–798 Author chain r； PDBConstruct 1–15； UniProt 784–798 Author chain t； PDBConstruct 1–15； UniProt 784–798 Author chain v； PDBConstruct 1–15； UniProt 784–798 Author chain x； PDBConstruct 1–15； UniProt 784–798 Author chain z； PDBConstruct 1–15； UniProt 784–798

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4dx9
Deposition date deposition_date	2012-02-27
Structure title title	ICAP1 in complex with integrin beta 1 cytoplasmic tail
Keywords keywords	Protein-protein complex, PTB domain, Integrin binding, Integrin beta-1, Membrane, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	59.52 Å
Radius of gyration Rg (electron density) rg_electron	59.51 Å
Forward intensity I(0) i0	2338420000.00
Molecular weight molecular_weight	420280.0 kDa
Excluded volume excluded_volume	531080 Å³
Envelope volume envelope_volume	904430 Å³
Hydration-shell volume shell_volume	125970 Å³
Envelope diameter envelope_diameter	202.2 Å
Shell Rg shell_rg	61.28 Å
Envelope Rg envelope_rg	58.62 Å
Shape Rg shape_rg	59.50 Å
Total Rg total_rg	59.60 Å
Total atoms total_atoms	29306
Residues n_residues	3703
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	204.1 Å
Rg (real space) rg_real	59.39 Å
Rg uncertainty (real space) rg_real_error	2.01 Å
I(0) (real space) i0_real	2.3380e+09
I(0) uncertainty (real space) i0_real_error	5.2820e+07
Rg (reciprocal space) rg_reciprocal	59.60 Å
I(0) (reciprocal space) i0_reciprocal	2339000000.0000
Solution quality estimate total_estimate	0.8656
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	70.6 Å
Skewness Skewness skewness	0.264
Kurtosis Kurtosis kurtosis	-0.372
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	134900000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.809; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.969; Smooth: 0.852

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Integrin beta-1-binding protein 1
Molecular weight formula_weight	17270.2 kDa
Source method src_method	man
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,0,k,m,1,C,2,E,3,G,o,q,I,4,K,5,M,O,a,s,u,c,e,g,i,Q,S,U,W,w,Y,y
Atom count atom_count	29306

GPLGSSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Integrin beta-1
Molecular weight formula_weight	1623.9 kDa
Source method src_method	syn
Copy count entity_count	30

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,n,x,D,8,H,p,B,9,F,r,J,7,L,6,N,P,t,v,b,d,f,h,j,R,T,V,X,Z,z

KSAVTTVVNPKYEGK

▼

7. Fold Classification (SCOP + CATH) 28 domains

CATH v4.4 (28 domains)

Domain ID domain_id	4dx9000
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9100
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9200
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9300
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9400
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9500
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9C00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9K00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9M00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9O00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9Q00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9S00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9U00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9Y00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9a00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9c00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9e00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9g00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9i00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9k00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9m00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9q00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	360 — Omega-AgatoxinV
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4dx9s00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9u00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

Domain ID domain_id	4dx9w00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	360 — Omega-AgatoxinV
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	4dx9y00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	29 — PH-domain like
Homologous superfamily homologous superfamily	30 — Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)

▶

8. Citations (1)

▶

Unit-cell length a length_a	75.622 Å
Unit-cell length b length_b	122.207 Å
Unit-cell length c length_c	135.269 Å
Unit-cell angle α angle_alpha	89.97 °
Unit-cell angle β angle_beta	89.99 °
Unit-cell angle γ angle_gamma	108.11 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.990 Å
Low-resolution limit resolution_low	50.010 Å
R factor r_factor	0.2546
R_work r_work	0.2513
R_free r_free	0.3119

fit	/app/data/saxs_computation/dx/4dx9/4dx9.fit
pddf	/app/data/pr_computation/dx/4dx9/4dx9.pr.out
profile	/app/data/saxs_computation/dx/4dx9/4dx9.dat

ICAP1 in complex with integrin beta 1 cytoplasmic tail

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integrin beta-1-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Integrin beta-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 28 domains

CATH v4.4 (28 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)