SAXSdb — 4e7v

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
10	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
11	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
12	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
13	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
14	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
15	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
16	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
17	Protein homooligomer	Homooligomer	Protein 12	M-CRESOL × 6 ZINC ION × 6 CHLORIDE ION × 6 water × 12	Consistent with protein count
18	Protein homooligomer	Homooligomer	Protein 12	M-CRESOL × 6 ZINC ION × 6 CHLORIDE ION × 6 water × 12	Consistent with protein count
19	Protein homooligomer	Homooligomer	Protein 12	M-CRESOL × 6 ZINC ION × 2 CHLORIDE ION × 2 water × 12	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 water × 2	Consistent with protein count
20	Protein homooligomer	Homooligomer	Protein 12	M-CRESOL × 6 ZINC ION × 2 CHLORIDE ION × 2 water × 12	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 CHLORIDE ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_BOVIN
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–21； UniProt 85–105 Author chain 3； PDBConstruct 1–21； UniProt 85–105 Author chain 5； PDBConstruct 1–21； UniProt 85–105 Author chain A； PDBConstruct 1–21； UniProt 85–105 Author chain C； PDBConstruct 1–21； UniProt 85–105 Author chain E； PDBConstruct 1–21； UniProt 85–105 Author chain G； PDBConstruct 1–21； UniProt 85–105 Author chain I； PDBConstruct 1–21； UniProt 85–105 Author chain K； PDBConstruct 1–21； UniProt 85–105 Author chain M； PDBConstruct 1–21； UniProt 85–105 Author chain O； PDBConstruct 1–21； UniProt 85–105 Author chain Q； PDBConstruct 1–21； UniProt 85–105 Author chain S； PDBConstruct 1–21； UniProt 85–105 Author chain U； PDBConstruct 1–21； UniProt 85–105 Author chain W； PDBConstruct 1–21； UniProt 85–105 Author chain Y； PDBConstruct 1–21； UniProt 85–105 Author chain 2； PDBConstruct 1–30； UniProt 25–54 Author chain 4； PDBConstruct 1–30； UniProt 25–54 Author chain 6； PDBConstruct 1–30； UniProt 25–54 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54 Author chain F； PDBConstruct 1–30； UniProt 25–54 Author chain H； PDBConstruct 1–30； UniProt 25–54 Author chain J； PDBConstruct 1–30； UniProt 25–54 Author chain L； PDBConstruct 1–30； UniProt 25–54 Author chain N； PDBConstruct 1–30； UniProt 25–54 Author chain P； PDBConstruct 1–30； UniProt 25–54 Author chain R； PDBConstruct 1–30； UniProt 25–54 Author chain T； PDBConstruct 1–30； UniProt 25–54 Author chain V； PDBConstruct 1–30； UniProt 25–54 Author chain X； PDBConstruct 1–30； UniProt 25–54 Author chain Z； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4e7v
Deposition date deposition_date	2012-03-19
Structure title title	The structure of R6 bovine insulin
Keywords keywords	Zinc binding, HORMONE; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4e7v__assembly_4__model_1

Assembly 4 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4e7v__assembly_4__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4e7v__assembly_4__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	11.78 Å
Rg (electron density)	10.59 Å
Total Rg	11.93 Å
Atom count	394
Residues	49
Excluded volume	7019 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4e7v__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4e7v__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4e7v__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4e7v__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4e7v__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4e7v__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4e7v__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4e7v__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`4e7v__assembly_9__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`4e7v__assembly_10__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`4e7v__assembly_11__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`4e7v__assembly_12__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`4e7v__assembly_13__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`4e7v__assembly_14__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
15	1	`4e7v__assembly_15__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
16	1	`4e7v__assembly_16__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
17	1	`4e7v__assembly_17__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
18	1	`4e7v__assembly_18__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
19	1	`4e7v__assembly_19__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
20	1	`4e7v__assembly_20__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Insulin A chain
Molecular weight formula_weight	2339.6 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W,Y,1,3,5
Atom count atom_count	6816

GIVEQCCASVCSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin B chain
Molecular weight formula_weight	3403.9 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X,Z,2,4,6

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Entity 3 Entity 3 non-polymer

Description description	M-CRESOL
Molecular weight formula_weight	108.1 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	454

▶

Unit-cell length a length_a	156.240 Å
Unit-cell length b length_b	156.240 Å
Unit-cell length c length_c	78.880 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	144

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	28.880 Å
R factor r_factor	0.2119
R_work r_work	0.2088
R_free r_free	0.2717

The structure of R6 bovine insulin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4e7v__assembly_4__model_1

4e7v__assembly_4__model_1 | I(q)

4e7v__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

The structure of R6 bovine insulin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4e7v__assembly_4__model_1

4e7v__assembly_4__model_1 | I(q)

4e7v__assembly_4__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)