SAXSdb — 4etp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein KAR3

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Spindle pole body-associated protein VIK1 × 1 （Q12045） ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 GLYCEROL × 6 N,N'-ethane-1,2-diylbis(2-iodoacetamide) × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KAR3_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 26–403； UniProt 352–729

Spindle pole body-associated protein VIK1

Saccharomyces cerevisiae

UniProt Q12045

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Kinesin-like protein KAR3 × 1 （P17119） ADENOSINE-5'-DIPHOSPHATE × 1 MAGNESIUM ION × 1 GLYCEROL × 6 N,N'-ethane-1,2-diylbis(2-iodoacetamide) × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VIK1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 27–333； UniProt 341–647

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4etp
Deposition date deposition_date	2012-04-24
Structure title title	C-terminal motor and motor homology domain of Kar3Vik1 fused to a synthetic heterodimeric coiled coil
Keywords keywords	;Kinesin Motor Protein, Kinesin Motor Homology Domain, karyogamy, mitosis, microtubules, internal Vik1 crosslink with N, N-Ethylenebis(iodoacetamide), Nucleus, MOTOR PROTEIN ;; MOTOR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4etp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4etp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4etp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.80 Å
Rg (electron density)	31.54 Å
Total Rg	32.27 Å
Atom count	5418
Residues	666
Excluded volume	96776 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4etp__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Kinesin-like protein KAR3
Molecular weight formula_weight	45178.9 kDa
Mutation mutation	C391L, C469A, C517A, C566V, C655V)
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5681

GASKIAALKEKIAALKEKIAALKEKIKDTELGMKELNEILIKEETVRRTLHNELQELRGNIRVYLRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVAIFAYGQTGSGKTFTMLNPGDGIIPSTISHIFNWINKLKTKGWDYKVNAEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSVKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSALGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVSRK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Spindle pole body-associated protein VIK1
Molecular weight formula_weight	38478.7 kDa
Mutation mutation	C377V, C436A, C536A, C596A, C640A, E355C, K423C)
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GASEIAALEKEIAALEKEIAALEKEISKQEKFYNDTYNTVCKELLRSRRLENSIIEQKGTMRVYAYVMEQNLPENLLFDYENGVITQGLSEHVYKFNRVIPHLKVSEDCFFTQEYSVYHDMALNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDYSHNDKDSIKLKFEKHSISLDSKLVIIENGLEDLPLNFSADEHPNLPHSGMGIIKVQFFPRDSKSDGNNDPVPVDFYFIELNNLKSIEQFDKSIFKKESAETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQLAKRKKKLT

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 6 Entity 6 non-polymer

Description description	N,N'-ethane-1,2-diylbis(2-iodoacetamide)
Molecular weight formula_weight	396.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	246

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	4etpA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	850 — Kinesin
Homologous superfamily homologous superfamily	10 — Kinesin motor domain

Domain ID domain_id	4etpB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	850 — Kinesin
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	88.060 Å
Unit-cell length b length_b	94.939 Å
Unit-cell length c length_c	114.590 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	24.970 Å
R factor r_factor	0.2092
R_work r_work	0.2073
R_free r_free	0.2447

C-terminal motor and motor homology domain of Kar3Vik1 fused to a synthetic heterodimeric coiled coil

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein KAR3

State in the Current Structure

Other States of the Same Protein in the Database

Spindle pole body-associated protein VIK1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4etp__assembly_1__model_1

4etp__assembly_1__model_1 | I(q)

4etp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

C-terminal motor and motor homology domain of Kar3Vik1 fused to a synthetic heterodimeric coiled coil

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kinesin-like protein KAR3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Spindle pole body-associated protein VIK1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4etp__assembly_1__model_1

4etp__assembly_1__model_1 | I(q)

4etp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)