4fao

Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Growth/differentiation factor 2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 6	Serine/threonine-protein kinase receptor R3 × 2 （P37023） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GDF2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–110； UniProt 320–429 Author chain B； PDBConstruct 1–110； UniProt 320–429 Author chain G； PDBConstruct 1–110； UniProt 320–429 Author chain H； PDBConstruct 1–110； UniProt 320–429 Author chain M； PDBConstruct 1–110； UniProt 320–429 Author chain N； PDBConstruct 1–110； UniProt 320–429 Author chain S； PDBConstruct 1–110； UniProt 320–429 Author chain T； PDBConstruct 1–110； UniProt 320–429 Author chain a； PDBConstruct 1–110； UniProt 320–429 Author chain b； PDBConstruct 1–110； UniProt 320–429 Author chain g； PDBConstruct 1–110； UniProt 320–429 Author chain h； PDBConstruct 1–110； UniProt 320–429

Serine/threonine-protein kinase receptor R3

Homo sapiens

UniProt P37023

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Activin receptor type-2B × 2 （Q13705） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACVL1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 3–99； UniProt 22–118 Author chain D； PDBConstruct 3–99； UniProt 22–118 Author chain I； PDBConstruct 3–99； UniProt 22–118 Author chain J； PDBConstruct 3–99； UniProt 22–118 Author chain O； PDBConstruct 3–99； UniProt 22–118 Author chain P； PDBConstruct 3–99； UniProt 22–118 Author chain U； PDBConstruct 3–99； UniProt 22–118 Author chain V； PDBConstruct 3–99； UniProt 22–118 Author chain c； PDBConstruct 3–99； UniProt 22–118 Author chain d； PDBConstruct 3–99； UniProt 22–118 Author chain i； PDBConstruct 3–99； UniProt 22–118 Author chain j； PDBConstruct 3–99； UniProt 22–118

Activin receptor type-2B

Homo sapiens

UniProt Q13705

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 6	Growth/differentiation factor 2 × 2 （Q9UK05） Serine/threonine-protein kinase receptor R3 × 2 （P37023） 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 SODIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AVR2B_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 3–118； UniProt 19–134 Author chain F； PDBConstruct 3–118； UniProt 19–134 Author chain K； PDBConstruct 3–118； UniProt 19–134 Author chain L； PDBConstruct 3–118； UniProt 19–134 Author chain Q； PDBConstruct 3–118； UniProt 19–134 Author chain R； PDBConstruct 3–118； UniProt 19–134 Author chain W； PDBConstruct 3–118； UniProt 19–134 Author chain X； PDBConstruct 3–118； UniProt 19–134 Author chain e； PDBConstruct 3–118； UniProt 19–134 Author chain f； PDBConstruct 3–118； UniProt 19–134 Author chain k； PDBConstruct 3–118； UniProt 19–134 Author chain l； PDBConstruct 3–118； UniProt 19–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4fao
Deposition date deposition_date	2012-05-22
Structure title title	Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex
Keywords keywords	tgf-beta, CTK, cystine knot, extracellular domain, receptor, SIGNALING PROTEIN-SIGNALING PROTEIN complex; SIGNALING PROTEIN/SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4fao__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4fao__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4fao__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.11 Å
Rg (electron density)	29.52 Å
Total Rg	30.03 Å
Atom count	4209
Residues	538
Excluded volume	73828 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4fao__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4fao__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4fao__assembly_3__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4fao__assembly_4__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4fao__assembly_5__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4fao__assembly_6__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Growth/differentiation factor 2
Molecular weight formula_weight	12103.0 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,G,H,M,N,S,T,a,b,g,h
Atom count atom_count	25411

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	Serine/threonine-protein kinase receptor R3
Molecular weight formula_weight	11592.9 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,I,J,O,P,U,V,c,d,i,j

GADPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQSGDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Cricetulus griseus

Entity 3 Entity 3 polymer

Description description	Activin receptor type-2B
Molecular weight formula_weight	14118.3 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,K,L,Q,R,W,X,e,f,k,l

GASGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGDDDDK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Cricetulus griseus

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	24

Entity 5 Entity 5 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	6

▼

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

Domain ID domain_id	4faoA00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoB00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoC00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoD00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoE00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoF00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoG00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoH00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoI00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoJ00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoK00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoL00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoM00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoN00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoO00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoP00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoQ00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoR00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoS00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoT00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoU00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoV00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoW00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoX00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoa00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faob00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoc00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faod00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoe00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faof00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faog00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoh00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	90 — Cystine Knot Cytokines, subunit B
Homologous superfamily homologous superfamily	10 — Cystine-knot cytokines

Domain ID domain_id	4faoi00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faoj00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faok00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

Domain ID domain_id	4faol00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	60 — CD59
Homologous superfamily homologous superfamily	10 — CD59

▶

Unit-cell length a length_a	216.453 Å
Unit-cell length b length_b	216.453 Å
Unit-cell length c length_c	216.953 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	72

Space group space_group	P 31 1 2
Space-group number int_tables_number	151
Crystal system crystal_system	—

Resolution resolution	3.357 Å
Low-resolution limit resolution_low	26.849 Å
R factor r_factor	0.2200
R_work r_work	0.2190
R_free r_free	0.2614

Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Growth/differentiation factor 2

State in the Current Structure

Other States of the Same Protein in the Database

Serine/threonine-protein kinase receptor R3

State in the Current Structure

Other States of the Same Protein in the Database

Activin receptor type-2B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4fao__assembly_3__model_1

4fao__assembly_3__model_1 | I(q)

4fao__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

7. Citations (1)

Specificity and Structure of a high affinity Activin-like 1 (ALK1) signaling complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Growth/differentiation factor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Serine/threonine-protein kinase receptor R3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Activin receptor type-2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4fao__assembly_3__model_1

4fao__assembly_3__model_1 | I(q)

4fao__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 36 domains

CATH v4.4 (36 domains)

7. Citations (1)