SAXSdb — 4g0s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Takeout-like protein 1

Epiphyas postvittana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	MYRISTIC ACID × 2 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	MYRISTIC ACID × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B5ABT1_EPIPO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–220； UniProt 21–240 Author chain B； PDBConstruct 1–220； UniProt 21–240

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4g0s
Deposition date deposition_date	2012-07-10
Structure title title	Crystal Structure of Epiphyas postvittana Takeout 1 expressed in Sf9 cells
Keywords keywords	transport protein; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4g0s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4g0s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4g0s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.75 Å
Rg (electron density)	19.63 Å
Total Rg	20.50 Å
Atom count	1751
Residues	219
Excluded volume	31843 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4g0s__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4g0s__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Takeout-like protein 1
Molecular weight formula_weight	24512.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3605

GVLPVEKCNLEDSACMTSAFQQALPTFVAGLPDHGVEVMDVLDLDDFAFDLSGLQFTLKEGKLKGLKGAVIDNVKWDLKKKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSYEMEKDAEGVDHVIFKKYTVTFDVKDNAQFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKPVMEAAAKKIFKNIKHFLAKVPIAEIANV

Source Source

Source organism organism	Epiphyas postvittana
Common name common_name	Light brown apple moth
NCBI taxonomy ID ncbi_taxonomy_id	65032
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	103

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	4g0sA00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	30 — TULIP domain

Domain ID domain_id	4g0sB00
Class class	3 — Alpha Beta
Architecture architecture	15 — Super Roll
Topology topology	10 — Bactericidal permeability-increasing protein; domain 1
Homologous superfamily homologous superfamily	30 — TULIP domain

▶

Unit-cell length a length_a	45.835 Å
Unit-cell length b length_b	55.184 Å
Unit-cell length c length_c	87.279 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.22 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.191 Å
Low-resolution limit resolution_low	45.800 Å
R factor r_factor	0.1975
R_work r_work	0.1938
R_free r_free	0.2760

Crystal Structure of Epiphyas postvittana Takeout 1 expressed in Sf9 cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Takeout-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4g0s__assembly_1__model_1

4g0s__assembly_1__model_1 | I(q)

4g0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (2)

Crystal Structure of Epiphyas postvittana Takeout 1 expressed in Sf9 cells

1. Protein Identity and Related Structures Protein Identity & Related Structures

Takeout-like protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4g0s__assembly_1__model_1

4g0s__assembly_1__model_1 | I(q)

4g0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (2)