4gam

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit

Method: X-RAY DIFFRACTION D_max: 161.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A beta chain

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain B； UniProt 1–389 Chain G； UniProt 1–389	Not recorded	Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain L； UniProt 1–389 Chain Q； UniProt 1–389	Not recorded	Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 4GAM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FYZ METHANE MONOOXYGENASE HYDROXYLASE, FORM II REDUCED BY SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.15 Å R-free 0.230
1FZ0 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GROWN ANAEROBICALLY Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.07 Å R-free 0.230
1FZ1 METHANE MONOOXYGENASE HYDROXYLASE, FORM III OXIDIZED Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.96 Å R-free 0.234
1FZ2 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GENERATED BY CRYSTAL SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.15 Å R-free 0.229
1FZ3 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAK AT PH 6.2 (0.1 M PIPES) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.03 Å R-free 0.228
1FZ4 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED AT PH 8.5 (0.1 M TRIS) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.38 Å R-free 0.256
1FZ5 METHANE MONOOXYGENASE HYDROXYLASE, FORM II CRYSTALLIZED ANAEROBICALLY FROM REDUCED ENZYME Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE2 FE (II) ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.40 Å R-free 0.253
1FZ6 METHANE MONOOXYGENASE HYDROXYLASE, FORM II SOAKED IN 1 M METHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 MOH METHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.05 Å R-free 0.244
1FZ7 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED IN 0.9 M ETHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1 EOH ETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 1.96 Å R-free 0.255
1FZ8 METHANE MONOOXYGENASE HYDROXYLASE, FORM II COCRYSTALLIZED WITH DIBROMOMETHANE Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 2BM DIBROMOMETHANE × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, dibromomethane, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.10 Å R-free 0.250
1FZ9 Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 ETI IODOETHANE × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, iodoethane. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.30 Å R-free 0.260
1FZH METHANE MONOOXYGENASE HYDROXYLASE, FORM II PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 XE XENON × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 8000, CaCl2, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 2.60 Å R-free 0.260
1FZI METHANE MONOOXYGENASE HYDROXYLASE, FORM I PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Chain D 1–389（389 aa）	Not recorded	FE FE (III) ION × 4 XE XENON × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 4000, ammonium acetate, Li2SO4, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.30 Å R-free 0.253
1MMO CRYSTAL STRUCTURE OF A BACTERIAL NON-HAEM IRON HYDROXYLASE THAT CATALYSES THE BIOLOGICAL OXIDATION OF METHANE Deposited 1994-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 6–389（384 aa） Chain C 6–389（384 aa）	Not recorded	FE FE (III) ION × 4 ACY ACETIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1MTY METHANE MONOOXYGENASE HYDROXYLASE FROM METHYLOCOCCUS CAPSULATUS (BATH) Deposited 1996-07-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 5–361（357 aa） Chain C 5–361（357 aa）	Not recorded	FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；25 MM LI2SO4, 50 MM NH4OAC, 5% PEG 4000, IN 25 MM MOPS PH 7.0 WITH A RESERVOIR OF 20% PEG 4000	Resolution 1.70 Å
1XMF Structure of Mn(II)-Soaked Apo Methane Monooxygenase Hydroxylase Crystals from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–388（388 aa） Fragment：beta subunit Chain D 1–388（388 aa） Fragment：beta subunit	Not recorded	MN MANGANESE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, CaCl2, PEG8000, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.32 Å R-free 0.263
1XMG Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–388（388 aa） Fragment：beta subunit Chain D 1–388（388 aa） Fragment：beta subunit	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.10 Å R-free 0.261
1XMH Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–388（388 aa） Fragment：beta subunit Chain D 1–388（388 aa） Fragment：beta subunit	Not recorded	CO COBALT (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, sodium azide, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.32 Å R-free 0.225
1XU3 Soluble methane monooxygenase hydroxylase-soaked with bromophenol Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 BML 4-BROMOPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K, pH 7.00	Resolution 2.30 Å R-free 0.245
1XU5 Soluble methane monooxygenase hydroxylase-phenol soaked Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 OH HYDROXIDE ION × 2 IPH PHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 1.96 Å R-free 0.228
1XVC soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 BR BROMIDE ION × 2 5BR 1-BROMOPENTANE × 1 BMM BROMOMETHANE × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.234
1XVD Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 FPN 4-FLUOROPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 2.30 Å R-free 0.229
1XVE soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 2 3BB 3-BROMOBUT-3-EN-1-OL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.260
1XVF soluble methane monooxygenase hydroxylase: chloropropanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 3CL 3-CHLOROPROPANOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.230
1XVG soluble methane monooxygenase hydroxylase: bromoethanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–389（389 aa） Fragment：beta subunit Chain D 1–389（389 aa） Fragment：beta subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 BRJ 2-BROMOETHANOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.96 Å R-free 0.230
7TC7 Cryo-EM structure of methane monooxygenase hydroxylase (by quantifoil) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–389（389 aa） Chain C 1–389（389 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7TC8 Cryo-EM structure of methane monooxygenase hydroxylase (by graphene) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–389（389 aa） Chain C 1–389（389 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

27 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MEMB_METCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–389； UniProt 1–389 Author chain G； PDBConstruct 1–389； UniProt 1–389 Author chain L； PDBConstruct 1–389； UniProt 1–389 Author chain Q； PDBConstruct 1–389； UniProt 1–389

Methane monooxygenase component A alpha chain

OrganismNot specified

UniProt P22869

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 1–527 Chain F； UniProt 1–527	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain K； UniProt 1–527 Chain P； UniProt 1–527	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4GAM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FYZ METHANE MONOOXYGENASE HYDROXYLASE, FORM II REDUCED BY SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.15 Å R-free 0.230
1FZ0 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GROWN ANAEROBICALLY Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.07 Å R-free 0.230
1FZ1 METHANE MONOOXYGENASE HYDROXYLASE, FORM III OXIDIZED Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.96 Å R-free 0.234
1FZ2 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GENERATED BY CRYSTAL SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.15 Å R-free 0.229
1FZ3 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAK AT PH 6.2 (0.1 M PIPES) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.03 Å R-free 0.228
1FZ4 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED AT PH 8.5 (0.1 M TRIS) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.38 Å R-free 0.256
1FZ5 METHANE MONOOXYGENASE HYDROXYLASE, FORM II CRYSTALLIZED ANAEROBICALLY FROM REDUCED ENZYME Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE2 FE (II) ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.40 Å R-free 0.253
1FZ6 METHANE MONOOXYGENASE HYDROXYLASE, FORM II SOAKED IN 1 M METHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 MOH METHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.05 Å R-free 0.244
1FZ7 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED IN 0.9 M ETHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1 EOH ETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 1.96 Å R-free 0.255
1FZ8 METHANE MONOOXYGENASE HYDROXYLASE, FORM II COCRYSTALLIZED WITH DIBROMOMETHANE Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 2BM DIBROMOMETHANE × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, dibromomethane, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.10 Å R-free 0.250
1FZ9 Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 ETI IODOETHANE × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, iodoethane. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.30 Å R-free 0.260
1FZH METHANE MONOOXYGENASE HYDROXYLASE, FORM II PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 XE XENON × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 8000, CaCl2, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 2.60 Å R-free 0.260
1FZI METHANE MONOOXYGENASE HYDROXYLASE, FORM I PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 XE XENON × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 4000, ammonium acetate, Li2SO4, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.30 Å R-free 0.253
1MMO CRYSTAL STRUCTURE OF A BACTERIAL NON-HAEM IRON HYDROXYLASE THAT CATALYSES THE BIOLOGICAL OXIDATION OF METHANE Deposited 1994-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 15–526（512 aa） Chain E 15–526（512 aa）	Not recorded	FE FE (III) ION × 4 ACY ACETIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1MTY METHANE MONOOXYGENASE HYDROXYLASE FROM METHYLOCOCCUS CAPSULATUS (BATH) Deposited 1996-07-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 15–526（512 aa） Chain E 15–526（512 aa）	Not recorded	FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；25 MM LI2SO4, 50 MM NH4OAC, 5% PEG 4000, IN 25 MM MOPS PH 7.0 WITH A RESERVOIR OF 20% PEG 4000	Resolution 1.70 Å
1XMF Structure of Mn(II)-Soaked Apo Methane Monooxygenase Hydroxylase Crystals from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	MN MANGANESE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, CaCl2, PEG8000, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.32 Å R-free 0.263
1XMG Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.10 Å R-free 0.261
1XMH Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	CO COBALT (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, sodium azide, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.32 Å R-free 0.225
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 BCM BICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain C 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 BCM BICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain D 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 BCM BICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain E 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 BCM BICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPO Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic bicyclomycin Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain F 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 BCM BICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；291 K；PEG 8000, Na Cacodylate, NaCl, glycerol, FOS-choline-12, pH 6.5, VAPOR DIFFUSION, temperature 18K	Resolution 3.15 Å R-free 0.306
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FB 5A-FORMYLBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain C 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FB 5A-FORMYLBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain D 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FB 5A-FORMYLBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain E 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FB 5A-FORMYLBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPR Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-formylbicyclomycin (FB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain F 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FB 5A-FORMYLBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 3350, Na Cacodylate, NaCl, glycerol, Na DihydrogenPhosphate, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.15 Å R-free 0.296
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain B 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FPD 5A-(3-FORMYLPHENYLSULFANYL)-DIHYDROBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain C 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FPD 5A-(3-FORMYLPHENYLSULFANYL)-DIHYDROBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain D 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 FPD 5A-(3-FORMYLPHENYLSULFANYL)-DIHYDROBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain E 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 2 FPD 5A-(3-FORMYLPHENYLSULFANYL)-DIHYDROBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XPU Structural mechanism of inhibition of the Rho transcription termination factor by the antibiotic 5a-(3-formylphenylsulfanyl)-dihydrobicyclomycin (FPDB) Deposited 2004-10-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein–RNA Monomer；Protein × 1 PDB declaration: dimeric	Chain F 1–419（419 aa）	Not recorded	MG MAGNESIUM ION × 1 FPD 5A-(3-FORMYLPHENYLSULFANYL)-DIHYDROBICYCLOMYCIN × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG 8000, Na Cacodylate, NaCl, Glycerol, FOS-Choline-12, pH 6.5, VAPOR DIFFUSION, temperature 293K	Resolution 3.05 Å R-free 0.295
1XU3 Soluble methane monooxygenase hydroxylase-soaked with bromophenol Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 BML 4-BROMOPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K, pH 7.00	Resolution 2.30 Å R-free 0.245
1XU5 Soluble methane monooxygenase hydroxylase-phenol soaked Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 OH HYDROXIDE ION × 2 IPH PHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 1.96 Å R-free 0.228
1XVB soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure Deposited 2004-10-27	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Chain B 1–527（527 aa）	Not recorded	FE FE (III) ION × 4 BHL 6-BROMOHEXAN-1-OL × 10 BBU 1-BROMOBUTANE × 1 BBX 1-BROMOETHANE × 1 CA CALCIUM ION × 1 3BR 1-BROMOPROPANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.251
1XVC soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 BR BROMIDE ION × 2 5BR 1-BROMOPENTANE × 1 BMM BROMOMETHANE × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.234
1XVD Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 FPN 4-FLUOROPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 2.30 Å R-free 0.229
1XVE soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 2 3BB 3-BROMOBUT-3-EN-1-OL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.260
1XVF soluble methane monooxygenase hydroxylase: chloropropanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 3CL 3-CHLOROPROPANOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.230
1XVG soluble methane monooxygenase hydroxylase: bromoethanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–527（527 aa） Fragment：alpha subunit Chain B 1–527（527 aa） Fragment：alpha subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 BRJ 2-BROMOETHANOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.96 Å R-free 0.230
7TC7 Cryo-EM structure of methane monooxygenase hydroxylase (by quantifoil) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–527（527 aa） Chain E 1–527（527 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7TC8 Cryo-EM structure of methane monooxygenase hydroxylase (by graphene) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–527（527 aa） Chain E 1–527（527 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

31 other PDB entries and 46 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MEMA_METCA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–527； UniProt 1–527 Author chain F； PDBConstruct 1–527； UniProt 1–527 Author chain K； PDBConstruct 1–527； UniProt 1–527 Author chain P； PDBConstruct 1–527； UniProt 1–527

Methane monooxygenase component A gamma chain

OrganismNot specified

UniProt P11987

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain C； UniProt 1–170 Chain H； UniProt 1–170	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain M； UniProt 1–170 Chain R； UniProt 1–170	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase regulatory protein B × 2 （P18797） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4GAM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1FYZ METHANE MONOOXYGENASE HYDROXYLASE, FORM II REDUCED BY SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.15 Å R-free 0.230
1FZ0 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GROWN ANAEROBICALLY Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.07 Å R-free 0.230
1FZ1 METHANE MONOOXYGENASE HYDROXYLASE, FORM III OXIDIZED Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.96 Å R-free 0.234
1FZ2 METHANE MONOOXYGENASE HYDROXYLASE, FORM II MIXED-VALENT GENERATED BY CRYSTAL SOAKING Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE2 FE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.15 Å R-free 0.229
1FZ3 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAK AT PH 6.2 (0.1 M PIPES) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.03 Å R-free 0.228
1FZ4 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED AT PH 8.5 (0.1 M TRIS) Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.38 Å R-free 0.256
1FZ5 METHANE MONOOXYGENASE HYDROXYLASE, FORM II CRYSTALLIZED ANAEROBICALLY FROM REDUCED ENZYME Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE2 FE (II) ION × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 2.40 Å R-free 0.253
1FZ6 METHANE MONOOXYGENASE HYDROXYLASE, FORM II SOAKED IN 1 M METHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 MOH METHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.05 Å R-free 0.244
1FZ7 METHANE MONOOXYGENASE HYDROXYLASE, FORM III SOAKED IN 0.9 M ETHANOL Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 FMT FORMIC ACID × 1 EOH ETHANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298 K	Resolution 1.96 Å R-free 0.255
1FZ8 METHANE MONOOXYGENASE HYDROXYLASE, FORM II COCRYSTALLIZED WITH DIBROMOMETHANE Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 2BM DIBROMOMETHANE × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, dibromomethane, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.10 Å R-free 0.250
1FZ9 Methane monooxygenase hydroxylase, form II cocrystallized with iodoethane Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 3 ETI IODOETHANE × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG 8000, CaCl2, MOPS, 1,10-decanedioic acid, iodoethane. pH 7.0, VAPOR DIFFUSION, HANGING DROP at 298K	Resolution 2.30 Å R-free 0.260
1FZH METHANE MONOOXYGENASE HYDROXYLASE, FORM II PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 XE XENON × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 8000, CaCl2, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 2.60 Å R-free 0.260
1FZI METHANE MONOOXYGENASE HYDROXYLASE, FORM I PRESSURIZED WITH XENON GAS Deposited 2000-10-03	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–170（170 aa） Chain F 1–170（170 aa）	Not recorded	FE FE (III) ION × 4 XE XENON × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG 4000, ammonium acetate, Li2SO4, MOPS, pH 7.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.30 Å R-free 0.253
1MMO CRYSTAL STRUCTURE OF A BACTERIAL NON-HAEM IRON HYDROXYLASE THAT CATALYSES THE BIOLOGICAL OXIDATION OF METHANE Deposited 1994-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 3–164（162 aa） Chain H 3–164（162 aa）	Not recorded	FE FE (III) ION × 4 ACY ACETIC ACID × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1MTY METHANE MONOOXYGENASE HYDROXYLASE FROM METHYLOCOCCUS CAPSULATUS (BATH) Deposited 1996-07-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 3–164（162 aa） Chain H 3–164（162 aa）	Not recorded	FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；25 MM LI2SO4, 50 MM NH4OAC, 5% PEG 4000, IN 25 MM MOPS PH 7.0 WITH A RESERVOIR OF 20% PEG 4000	Resolution 1.70 Å
1XMF Structure of Mn(II)-Soaked Apo Methane Monooxygenase Hydroxylase Crystals from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–169（169 aa） Fragment：gamma subunit Chain F 1–169（169 aa） Fragment：gamma subunit	Not recorded	MN MANGANESE (II) ION × 4 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, CaCl2, PEG8000, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.32 Å R-free 0.263
1XMG Crystal structure of apo methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–169（169 aa） Fragment：gamma subunit Chain F 1–169（169 aa） Fragment：gamma subunit	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, glycerol, azide, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.10 Å R-free 0.261
1XMH Structure of Co(II) reconstituted methane monooxygenase hydroxylase from M. capsulatus (Bath) Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–169（169 aa） Fragment：gamma subunit Chain F 1–169（169 aa） Fragment：gamma subunit	Not recorded	CO COBALT (II) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；278 K；MOPS, PEG 8000, calcium chloride, sodium azide, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 278K	Resolution 2.32 Å R-free 0.225
1XU3 Soluble methane monooxygenase hydroxylase-soaked with bromophenol Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 BML 4-BROMOPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K, pH 7.00	Resolution 2.30 Å R-free 0.245
1XU5 Soluble methane monooxygenase hydroxylase-phenol soaked Deposited 2004-10-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 OH HYDROXIDE ION × 2 IPH PHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 1.96 Å R-free 0.228
1XVB soluble methane monooxygenase hydroxylase: 6-bromohexanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Chain F 0–169（170 aa）	Not recorded	FE FE (III) ION × 4 BHL 6-BROMOHEXAN-1-OL × 10 BBU 1-BROMOBUTANE × 1 BBX 1-BROMOETHANE × 1 CA CALCIUM ION × 1 3BR 1-BROMOPROPANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.80 Å R-free 0.251
1XVC soluble methane monooxygenase hydroxylase: 8-bromooctanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 BR BROMIDE ION × 2 5BR 1-BROMOPENTANE × 1 BMM BROMOMETHANE × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.234
1XVD Soluble methane monooxygenase hydroxylase: 4-fluorophenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 FPN 4-FLUOROPHENOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；273 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 273K	Resolution 2.30 Å R-free 0.229
1XVE soluble methane monooxygenase hydroxylase: 3-bromo-3-butenol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 2 3BB 3-BROMOBUT-3-EN-1-OL × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.40 Å R-free 0.260
1XVF soluble methane monooxygenase hydroxylase: chloropropanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 3CL 3-CHLOROPROPANOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, NaN3, CaCl2, glycerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.230
1XVG soluble methane monooxygenase hydroxylase: bromoethanol soaked structure Deposited 2004-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 0–169（170 aa） Fragment：gamma subunit Chain F 0–169（170 aa） Fragment：gamma subunit	Not recorded	FE FE (III) ION × 4 CA CALCIUM ION × 4 BRJ 2-BROMOETHANOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；MOPS, PEG 8000, CaCl2, NaN3, glyerol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.96 Å R-free 0.230
7TC7 Cryo-EM structure of methane monooxygenase hydroxylase (by quantifoil) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–170（170 aa） Chain H 1–170（170 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7TC8 Cryo-EM structure of methane monooxygenase hydroxylase (by graphene) Deposited 2021-12-23	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–170（170 aa） Chain H 1–170（170 aa）	Not recorded	FE FE (III) ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7；30 mM HEPES, pH 7, 150 mM NaCl, 1 mM TCEP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å

28 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MEMG_METCA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–170； UniProt 1–170 Author chain H； PDBConstruct 1–170； UniProt 1–170 Author chain M； PDBConstruct 1–170； UniProt 1–170 Author chain R； PDBConstruct 1–170； UniProt 1–170

Methane monooxygenase regulatory protein B

Methylococcus capsulatus

UniProt P18797

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain D； UniProt 1–141 Chain I； UniProt 1–141	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain N； UniProt 1–141 Chain S； UniProt 1–141	Not recorded	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） FE FE (III) ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.1 M MES and 15% PEG 20,000 (w/v) ure 298K, pH 6.5, VAPOR DIFFUSION, SITTING DROP	Resolution 2.90 Å R-free 0.258

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 4GAM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1CKV STRUCTURE OF THE SOLUBLE METHANE MONOOXYGENASE REGULATORY PROTEIN B Deposited 1999-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–141（141 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50 mM PHOSPHATE NMR sample composition 4 MM PEFAPLOC	Resolution not provided

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MMOB_METCA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141 Author chain I； PDBConstruct 1–141； UniProt 1–141 Author chain N； PDBConstruct 1–141； UniProt 1–141 Author chain S； PDBConstruct 1–141； UniProt 1–141

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4gam
Deposition date deposition_date	2012-07-25
Structure title title	Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
Keywords keywords	Methane Monooxygenase, hydroxylase, regulatory subunit B, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	51.76 Å
Radius of gyration Rg (electron density) rg_electron	51.29 Å
Forward intensity I(0) i0	4287900000.00
Molecular weight molecular_weight	552830.0 kDa
Excluded volume excluded_volume	690620 Å³
Envelope volume envelope_volume	836630 Å³
Hydration-shell volume shell_volume	126430 Å³
Envelope diameter envelope_diameter	172.0 Å
Shell Rg shell_rg	61.60 Å
Envelope Rg envelope_rg	50.79 Å
Shape Rg shape_rg	51.28 Å
Total Rg total_rg	51.57 Å
Total atoms total_atoms	39100
Residues n_residues	4788
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	161.8 Å
Rg (real space) rg_real	51.55 Å
Rg uncertainty (real space) rg_real_error	0.98 Å
I(0) (real space) i0_real	4.2880e+09
I(0) uncertainty (real space) i0_real_error	8.1160e+07
Rg (reciprocal space) rg_reciprocal	51.93 Å
I(0) (reciprocal space) i0_reciprocal	4290000000.0000
Solution quality estimate total_estimate	0.8766
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	70.1 Å
Skewness Skewness skewness	0.137
Kurtosis Kurtosis kurtosis	-0.460
Angular range angular_range	— – 0.1500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1742000000.0000
Real-space data points n_real_points	31
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.915; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.960; Smooth: 0.686

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Methane monooxygenase component A beta chain
Molecular weight formula_weight	45184.7 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,L,Q
Atom count atom_count	39145

MSMLGERRRGLTDPEMAAVILKALPEAPLDGNNKMGYFVTPRWKRLTEYEALTVYAQPNADWIAGGLDWGDWTQKFHGGRPSWGNETTELRTVDWFKHRDPLRRWHAPYVKDKAEEWRYTDRFLQGYSADGQIRAMNPTWRDEFINRYWGAFLFNEYGLFNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVPGFDESTAVPKAEWTNGEVYKSARLAVEGLWQEVFDWNESAFSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPFFINQAQTYFQIAKQGVQDLYYNCLGDDPEFSDYNRTVMRNWTGKWLEPTIAALRDFMGLFAKLPAGTTDKEEITASLYRVVDDWIEDYASRIDFKADRDQIVKAVLAGLK

Entity 2 Entity 2 polymer

Description description	Methane monooxygenase component A alpha chain
Molecular weight formula_weight	60717.1 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,K,P

MALSTATKAATDALAANRAPTSVNAQEVHRWLQSFNWDFKNNRTKYATKYKMANETKEQFKLIAKEYARMEAVKDERQFGSLQDALTRLNAGVRVHPKWNETMKVVSNFLEVGEYNAIAATGMLWDSAQAAEQKNGYLAQVLDEIRHTHQCAYVNYYFAKNGQDPAGHNDARRTRTIGPLWKGMKRVFSDGFISGDAVECSLNLQLVGEACFTNPLIVAVTEWAAANGDEITPTVFLSIETDELRHMANGYQTVVSIANDPASAKYLNTDLNNAFWTQQKYFTPVLGMLFEYGSKFKVEPWVKTWNRWVYEDWGGIWIGRLGKYGVESPRSLKDAKQDAYWAHHDLYLLAYALWPTGFFRLALPDQEEMEWFEANYPGWYDHYGKIYEEWRARGCEDPSSGFIPLMWFIENNHPIYIDRVSQVPFCPSLAKGASTLRVHEYNGQMHTFSDQWGERMWLAEPERYECQNIFEQYEGRELSEVIAELHGLRSDGKTLIAQPHVRGDKLWTLDDIKRLNCVFKNPVKAFN

Entity 3 Entity 3 polymer

Description description	Methane monooxygenase component A gamma chain
Molecular weight formula_weight	19879.7 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H,M,R

MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPH

Entity 4 Entity 4 polymer

Description description	Methane monooxygenase regulatory protein B
Molecular weight formula_weight	15999.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I,N,S

MSVNSNAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSELMGLDRKLEDYHA

来源 Source

来源生物 organism	Methylococcus capsulatus
NCBI Class编号 ncbi_taxonomy_id	243233
宿主生物 host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	45

▼

7. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d4gama_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamb_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamc_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gamd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamf_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamg_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamh_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gami_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamk_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gaml_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamm_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gamn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamp_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamq_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamr_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gams_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

CATH v4.4 (20 domains)

Domain ID domain_id	4gamA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamD00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamH02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamI00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamM02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamN00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamP00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamR02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamS00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

▶

8. Citations (1)

▶

Unit-cell length a length_a	183.590 Å
Unit-cell length b length_b	248.970 Å
Unit-cell length c length_c	122.290 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.902 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2082
R_work r_work	0.2055
R_free r_free	0.2584

fit	/app/data/saxs_computation/ga/4gam/4gam.fit
pddf	/app/data/pr_computation/ga/4gam/4gam.pr.out
profile	/app/data/saxs_computation/ga/4gam/4gam.dat

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase component A alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase component A gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase regulatory protein B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (16 domains)

CATH v4.4 (20 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)