4gam

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A beta chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEMB_METCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–389； UniProt 1–389 Author chain G； PDBConstruct 1–389； UniProt 1–389 Author chain L； PDBConstruct 1–389； UniProt 1–389 Author chain Q； PDBConstruct 1–389； UniProt 1–389

Methane monooxygenase component A alpha chain

OrganismNot specified

UniProt P22869

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A gamma chain × 2 （P11987） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEMA_METCA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–527； UniProt 1–527 Author chain F； PDBConstruct 1–527； UniProt 1–527 Author chain K； PDBConstruct 1–527； UniProt 1–527 Author chain P； PDBConstruct 1–527； UniProt 1–527

Methane monooxygenase component A gamma chain

OrganismNot specified

UniProt P11987

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase regulatory protein B × 2 （P18797） FE (III) ION × 4 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MEMG_METCA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–170； UniProt 1–170 Author chain H； PDBConstruct 1–170； UniProt 1–170 Author chain M； PDBConstruct 1–170； UniProt 1–170 Author chain R； PDBConstruct 1–170； UniProt 1–170

Methane monooxygenase regulatory protein B

Methylococcus capsulatus

UniProt P18797

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） FE (III) ION × 4 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	Methane monooxygenase component A beta chain × 2 （P18798） Methane monooxygenase component A alpha chain × 2 （P22869） Methane monooxygenase component A gamma chain × 2 （P11987） FE (III) ION × 4 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MMOB_METCA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–141； UniProt 1–141 Author chain I； PDBConstruct 1–141； UniProt 1–141 Author chain N； PDBConstruct 1–141； UniProt 1–141 Author chain S； PDBConstruct 1–141； UniProt 1–141

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4gam
Deposition date deposition_date	2012-07-25
Structure title title	Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
Keywords keywords	Methane Monooxygenase, hydroxylase, regulatory subunit B, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4gam__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4gam__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4gam__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.62 Å
Rg (electron density)	40.16 Å
Total Rg	40.57 Å
Atom count	19550
Residues	2394
Excluded volume	345310 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4gam__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4gam__assembly_2__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Methane monooxygenase component A beta chain
Molecular weight formula_weight	45184.7 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,L,Q
Atom count atom_count	39145

MSMLGERRRGLTDPEMAAVILKALPEAPLDGNNKMGYFVTPRWKRLTEYEALTVYAQPNADWIAGGLDWGDWTQKFHGGRPSWGNETTELRTVDWFKHRDPLRRWHAPYVKDKAEEWRYTDRFLQGYSADGQIRAMNPTWRDEFINRYWGAFLFNEYGLFNAHSQGAREALSDVTRVSLAFWGFDKIDIAQMIQLERGFLAKIVPGFDESTAVPKAEWTNGEVYKSARLAVEGLWQEVFDWNESAFSVHAVYDALFGQFVRREFFQRLAPRFGDNLTPFFINQAQTYFQIAKQGVQDLYYNCLGDDPEFSDYNRTVMRNWTGKWLEPTIAALRDFMGLFAKLPAGTTDKEEITASLYRVVDDWIEDYASRIDFKADRDQIVKAVLAGLK

Entity 2 Entity 2 polymer

Description description	Methane monooxygenase component A alpha chain
Molecular weight formula_weight	60717.1 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,K,P

MALSTATKAATDALAANRAPTSVNAQEVHRWLQSFNWDFKNNRTKYATKYKMANETKEQFKLIAKEYARMEAVKDERQFGSLQDALTRLNAGVRVHPKWNETMKVVSNFLEVGEYNAIAATGMLWDSAQAAEQKNGYLAQVLDEIRHTHQCAYVNYYFAKNGQDPAGHNDARRTRTIGPLWKGMKRVFSDGFISGDAVECSLNLQLVGEACFTNPLIVAVTEWAAANGDEITPTVFLSIETDELRHMANGYQTVVSIANDPASAKYLNTDLNNAFWTQQKYFTPVLGMLFEYGSKFKVEPWVKTWNRWVYEDWGGIWIGRLGKYGVESPRSLKDAKQDAYWAHHDLYLLAYALWPTGFFRLALPDQEEMEWFEANYPGWYDHYGKIYEEWRARGCEDPSSGFIPLMWFIENNHPIYIDRVSQVPFCPSLAKGASTLRVHEYNGQMHTFSDQWGERMWLAEPERYECQNIFEQYEGRELSEVIAELHGLRSDGKTLIAQPHVRGDKLWTLDDIKRLNCVFKNPVKAFN

Entity 3 Entity 3 polymer

Description description	Methane monooxygenase component A gamma chain
Molecular weight formula_weight	19879.7 kDa
EC 编号 ec_number	1.14.13.25
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H,M,R

MAKLGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVHLQSPH

Entity 4 Entity 4 polymer

Description description	Methane monooxygenase regulatory protein B
Molecular weight formula_weight	15999.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I,N,S

MSVNSNAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGYWWIKANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAYTLGNKFTITSELMGLDRKLEDYHA

Source Source

Source organism organism	Methylococcus capsulatus
NCBI taxonomy ID ncbi_taxonomy_id	243233
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	45

▼

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d4gama_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamb_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamc_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gamd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamf_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamg_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamh_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gami_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamk_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gaml_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamm_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gamn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

Domain ID domain_id	d4gamp_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamq_
Class class	a — All alpha proteins
Fold Fold fold	a.25 — Ferritin-like
Superfamily Superfamily superfamily	a.25.1 — Ferritin-like
Family Family family	a.25.1.2 — Ribonucleotide reductase-like

Domain ID domain_id	d4gamr_
Class class	a — All alpha proteins
Fold Fold fold	a.23 — Open three-helical up-and-down bundle
Superfamily Superfamily superfamily	a.23.3 — Methane monooxygenase hydrolase, gamma subunit
Family Family family	a.23.3.1 — Methane monooxygenase hydrolase, gamma subunit

Domain ID domain_id	d4gams_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.137 — Monooxygenase (hydroxylase) regulatory protein
Superfamily Superfamily superfamily	d.137.1 — Monooxygenase (hydroxylase) regulatory protein
Family Family family	d.137.1.1 — Monooxygenase (hydroxylase) regulatory protein

CATH v4.4 (20 domains)

Domain ID domain_id	4gamA00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamB00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamC01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamD00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamF00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamG00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamH02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamI00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamK00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamL00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamM02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamN00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

Domain ID domain_id	4gamP00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	620 — Ribonucleotide Reductase, subunit A
Homologous superfamily homologous superfamily	20 — Ribonucleotide Reductase, subunit A

Domain ID domain_id	4gamR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	10 — Methane monooxygenase, gamma chain, domain 1

Domain ID domain_id	4gamR02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1280 — Monooxygenase
Homologous superfamily homologous superfamily	30 — Methane monooxygenase, gamma chain, domain 2

Domain ID domain_id	4gamS00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	56 — Phenol Hydroxylase P2 Protein
Homologous superfamily homologous superfamily	10 — Monooxygenase component MmoB/DmpM

▶

Unit-cell length a length_a	183.590 Å
Unit-cell length b length_b	248.970 Å
Unit-cell length c length_c	122.290 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.902 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.2082
R_work r_work	0.2055
R_free r_free	0.2584

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase component A alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase component A gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Methane monooxygenase regulatory protein B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gam__assembly_1__model_1

4gam__assembly_1__model_1 | I(q)

4gam__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (16 domains)

CATH v4.4 (20 domains)

7. Citations (1)

Complex structure of Methane monooxygenase hydroxylase and regulatory subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

Methane monooxygenase component A beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase component A alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase component A gamma chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Methane monooxygenase regulatory protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4gam__assembly_1__model_1

4gam__assembly_1__model_1 | I(q)

4gam__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 36 domains

SCOP 2.08 (16 domains)

CATH v4.4 (20 domains)

7. Citations (1)