SAXSdb — 4ggn

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin A tail domain interacting protein MTIP

Plasmodium knowlesi

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Myosin-A × 1 （Q7RQ71） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Myosin-A × 1 （Q7RQ71） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Myosin-A × 1 （Q7RQ71） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B3LDA6_PLAKH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–127； UniProt 79–205 Author chain B； PDBConstruct 1–127； UniProt 79–205 Author chain C； PDBConstruct 1–127； UniProt 79–205

Myosin-A

Plasmodium yoelii yoelii

UniProt Q7RQ71

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Myosin A tail domain interacting protein MTIP × 1 （B3LDA6） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Myosin A tail domain interacting protein MTIP × 1 （B3LDA6） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Myosin A tail domain interacting protein MTIP × 1 （B3LDA6） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MYOA_PLAYO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–15； UniProt 803–817 Author chain E； PDBConstruct 1–15； UniProt 803–817 Author chain F； PDBConstruct 1–15； UniProt 803–817

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4ggn
Deposition date deposition_date	2012-08-06
Structure title title	Malaria invasion machinery protein complex
Keywords keywords	Malaria invasion machinery protein, PROTEIN BINDING, MTIP, MYOA, MYOSIN A-TAIL, MYOA-TAIL INTERACTING PROTEIN; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4ggn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4ggn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4ggn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.17 Å
Rg (electron density)	16.49 Å
Total Rg	17.26 Å
Atom count	1131
Residues	140
Excluded volume	19962 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4ggn__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4ggn__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4ggn__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Myosin A tail domain interacting protein MTIP
Molecular weight formula_weight	14665.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3611

KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDILS

Source Source

Source organism organism	Plasmodium knowlesi
NCBI taxonomy ID ncbi_taxonomy_id	5851
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Myosin-A
Molecular weight formula_weight	1801.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

SLMRVQAHIRKRMVA

Source Source

Source organism organism	Plasmodium yoelii yoelii
NCBI taxonomy ID ncbi_taxonomy_id	73239
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	191

▼

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d4ggna_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.0 — automated matches

Domain ID domain_id	d4ggnb_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.0 — automated matches

Domain ID domain_id	d4ggnc_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.0 — automated matches

CATH v4.4 (6 domains)

Domain ID domain_id	4ggnA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ggnA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ggnB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ggnB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ggnC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	4ggnC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	82.560 Å
Unit-cell length b length_b	83.403 Å
Unit-cell length c length_c	84.316 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.290 Å
Low-resolution limit resolution_low	41.700 Å
R factor r_factor	0.2284
R_work r_work	0.2258
R_free r_free	0.2794

Malaria invasion machinery protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin A tail domain interacting protein MTIP

State in the Current Structure

Other States of the Same Protein in the Database

Myosin-A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ggn__assembly_1__model_1

4ggn__assembly_1__model_1 | I(q)

4ggn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)

Malaria invasion machinery protein complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin A tail domain interacting protein MTIP

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4ggn__assembly_1__model_1

4ggn__assembly_1__model_1 | I(q)

4ggn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 9 domains

SCOP 2.08 (3 domains)

CATH v4.4 (6 domains)

7. Citations (1)